BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0013 (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48345| Best HMM Match : Ribosomal_L22 (HMM E-Value=0) 56 3e-08 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 34 0.096 SB_681| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_51044| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_41585| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_30772| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-09) 28 8.4 >SB_48345| Best HMM Match : Ribosomal_L22 (HMM E-Value=0) Length = 142 Score = 56.0 bits (129), Expect = 3e-08 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = +2 Query: 497 TGAGNPAKSCKARGSNLRVHFKNXYETAMAIRKMPLR 607 T NP KSCKARGSNLRVH+KN +E AMAI+ M +R Sbjct: 6 TDPENPTKSCKARGSNLRVHYKNTHEAAMAIKGMHVR 42 Score = 28.3 bits (60), Expect = 6.3 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +1 Query: 619 RYLKNVIDKKECIPFRRF 672 RYLK+V KK+ +PFR++ Sbjct: 46 RYLKDVCAKKQLVPFRKY 63 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 34.3 bits (75), Expect = 0.096 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = -1 Query: 470 ENEKHRSNSELQY*AASRRHFPTSEPRQRTASRALEDRGATTRSEAQRAL 321 E EK+ + EL+ S HF E ++R RA+ED+ +SE ++ L Sbjct: 332 EEEKYGKDGELRMLKESLAHFQAEEAKKREQIRAMEDQRKQEQSEKEKEL 381 >SB_681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 29.1 bits (62), Expect = 3.6 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +1 Query: 415 RRLAA*YCNSLFERCFSFSVLNIR*LKNGSRKPCEIMQSAWFKPP 549 RRL+ +C R F+ +VL ++ +N +KP E Q F+PP Sbjct: 20 RRLSDNWCRCPKARSFNSAVLRLKITRNNIKKPTEEQQ---FRPP 61 >SB_51044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 28.3 bits (60), Expect = 6.3 Identities = 22/104 (21%), Positives = 42/104 (40%), Gaps = 1/104 (0%) Frame = -2 Query: 451 RTASYNIKRPVAD-ISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNGDS 275 ++ S ++ + V+ +SQ + QP + + RRG R +++ A L Sbjct: 382 QSVSQSVSQSVSQSVSQSVSQSVSQPGQNARDYWIRRGLSYLERYFFLILFNAYLHEQTF 441 Query: 274 VTSNAHRVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARR 143 HR W++R+ H+ G+ S + TC + R Sbjct: 442 CRWMRHRP--WIYRMLSHIDIKEKGATSEFMMRTHQPTCLVSGR 483 >SB_41585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +3 Query: 504 PETLRNHAKRVVQTSVFTLRTHMRPQWQSERCRSVR 611 P LR++A VQT R+H P E R VR Sbjct: 63 PRCLRHYAMTAVQTKTILNRSHSLPALTFESARKVR 98 >SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1143 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = -3 Query: 429 SGQSPTFPNIRTTTANSLQSS*RPRCHDAERSSTRALRPYSSEERRS 289 S +SP+ P RTT S ++S + R++ R +SS +RR+ Sbjct: 155 SSKSPSPPTNRTTQGESPKTSSSGHGQHSSRTAVRRSASFSSSQRRT 201 >SB_30772| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-09) Length = 207 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -2 Query: 364 KTAVPRRGAKLNARSTSILVRGASLGNGDSVTSNAHR 254 KTAVPRRG K S++ R + + + +TS HR Sbjct: 112 KTAVPRRGVK-GLPLNSVIRRLVDVHSSEGMTSARHR 147 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,367,693 Number of Sequences: 59808 Number of extensions: 419000 Number of successful extensions: 1091 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1020 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1091 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -