BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0009 (698 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0750 + 5574707-5576017 29 3.5 02_03_0199 + 16263549-16263644,16264941-16265899,16267140-162677... 29 4.7 05_01_0475 - 3818121-3820565 28 6.2 02_02_0206 - 7771835-7771913,7772083-7772219,7772364-7772422,777... 28 6.2 >02_01_0750 + 5574707-5576017 Length = 436 Score = 29.1 bits (62), Expect = 3.5 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = -3 Query: 354 TTNFFLWLAIMFLYDYRRFIYVDKLSIFSCFYYDLVS 244 T FF++ + +FL +RFIY+D L C Y D+ S Sbjct: 302 TKPFFMYKSKLFLGSQKRFIYIDILDGTVC-YVDIPS 337 >02_03_0199 + 16263549-16263644,16264941-16265899,16267140-16267791, 16267895-16267981,16268253-16268381,16269990-16270036, 16271337-16271438,16272720-16272843,16272981-16273028, 16273934-16274026,16274325-16274408,16274536-16274619, 16274751-16274819,16275531-16275590,16275946-16276017, 16276957-16277064,16278162-16278238,16278391-16278474, 16278617-16278728,16278778-16278810,16278811-16278900, 16279012-16279077,16279163-16279258,16279446-16279497, 16279723-16279775,16279998-16280018 Length = 1165 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -1 Query: 659 FGSPQVSRKEEGSDLHSL 606 FG+P + R+EEGSD+HSL Sbjct: 123 FGNPNM-RREEGSDMHSL 139 >05_01_0475 - 3818121-3820565 Length = 814 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +2 Query: 122 LKMDMNNPPNQSYWFVLREDQSNVILS-TNNFVNQNPQ 232 + + +NPPN YW E S+ ++S N +N NP+ Sbjct: 209 IDLSRSNPPNM-YWSWSSEKSSSALISLLNQLININPE 245 >02_02_0206 - 7771835-7771913,7772083-7772219,7772364-7772422, 7772535-7772610,7772717-7772873,7773241-7773329, 7773648-7773750,7773919-7774013,7774301-7774367, 7774894-7775066 Length = 344 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 3/33 (9%) Frame = +1 Query: 562 KEIQMGAYNTCEEVFKECKSLPS---SFLETWG 651 KE+ YNT VFK K+ + SF +TWG Sbjct: 238 KEVFSSIYNTLRHVFKYVKAYTAHVPSFADTWG 270 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,774,674 Number of Sequences: 37544 Number of extensions: 311170 Number of successful extensions: 584 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 571 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 584 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -