BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0009 (698 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g02740.1 68417.m00374 F-box family protein contains Pfam PF00... 30 1.7 At5g19530.1 68418.m02326 spermine/spermidine synthase family pro... 29 2.2 At1g53645.1 68414.m06102 hydroxyproline-rich glycoprotein family... 29 3.0 At5g66300.1 68418.m08359 no apical meristem (NAM) family protein... 27 9.0 >At4g02740.1 68417.m00374 F-box family protein contains Pfam PF00646: F-box domain; similar to F-box protein FBL2 (GI:6063090) [Homo sapiens] Length = 645 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 4/33 (12%) Frame = +1 Query: 574 MGAYNTCEEVF----KECKSLPSSFLETWGDPK 660 +G YN EE+F K+C+ + FLET+G P+ Sbjct: 199 VGLYNLTEELFNSLTKKCRLIEHLFLETYGYPR 231 >At5g19530.1 68418.m02326 spermine/spermidine synthase family protein similar to SP|P09158 Spermidine synthase (EC 2.5.1.16) (Putrescine aminopropyltransferase) {Escherichia coli}; contains Pfam profile PF01564: Spermine/spermidine synthase Length = 339 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 3/33 (9%) Frame = +1 Query: 562 KEIQMGAYNTCEEVFKECKSLPS---SFLETWG 651 KE+ YNT ++VFK K+ + SF +TWG Sbjct: 232 KEVFTSIYNTMKQVFKYVKAYTAHVPSFADTWG 264 >At1g53645.1 68414.m06102 hydroxyproline-rich glycoprotein family protein Length = 523 Score = 29.1 bits (62), Expect = 3.0 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +1 Query: 229 PNSTSRDKIVVETGENRQFIH--INEPPIIVQEHDSQPQEKVCSTTKD 366 P+ R K +VE+ RQ + I PP Q+ QPQ+K T KD Sbjct: 214 PSGAGRGKPLVESAPIRQEDNRQIRRPPPPPQQQRVQPQQKRAPTVKD 261 >At5g66300.1 68418.m08359 no apical meristem (NAM) family protein similar to NAC2 (GI:6456751) [Arabidopsis thaliana]; contains Pfam PF02365 : No apical meristem (NAM) protein Length = 292 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = +2 Query: 104 LFRYFSLKMDMNNPPNQSYWFVLREDQSNVILST 205 + Y+SL+ N+PP + W V R + + T Sbjct: 135 IHEYYSLESHQNSPPQEEGWVVCRAFKKRTTIPT 168 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,464,076 Number of Sequences: 28952 Number of extensions: 284600 Number of successful extensions: 637 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 623 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 637 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -