BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0008 (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9743| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_57739| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_10512| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_57782| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_54236| Best HMM Match : bZIP_1 (HMM E-Value=1.1) 29 4.8 SB_56940| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_7455| Best HMM Match : HC2 (HMM E-Value=8.7) 28 6.3 SB_15593| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_16907| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_9743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +2 Query: 470 NERHPADTGRWRAQGQASPGIFNSRGAADGSDISSRRFID 589 N + AD G + +G+A G+FN +G AD +++R D Sbjct: 70 NNKGVADKGLFNNKGEADKGLFNDKGEADKGLFNNKRVAD 109 >SB_57739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 30.3 bits (65), Expect = 1.6 Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 6/89 (6%) Frame = +3 Query: 303 YIEDENVEFPTCCARLRCVVEVNGERI----VQTRGQPGELFPDKPWKGQQNEPNPAVV- 467 Y+ D C R+RC+ N R V TR + G + + + PA+V Sbjct: 280 YVGDIKQNRMKCLVRVRCIHSANQHRASHVTVFTRQRVGNGLLQAVYNHEYEKCVPAIVL 339 Query: 468 -GMSGIQQTPVGGEPRVRRLLEYLTAEEQ 551 + ++Q V +PR RRLL+ +EQ Sbjct: 340 APVFAVEQGKVPVKPRGRRLLKKKDMDEQ 368 >SB_10512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 29.5 bits (63), Expect = 2.7 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = +3 Query: 252 CGCRKPKIPENALECHEYIEDENVEFPTCCARLRC 356 C +KP +P++ HE + + C R RC Sbjct: 28 CLAQKPGVPQDTRHSHEPLPQRKISLIVCSTRTRC 62 >SB_57782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 310 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -1 Query: 119 SADRAGKTRQHNINNAPNCFPCCIL 45 SA+ K R H+ N +CF CCIL Sbjct: 279 SANDKKKKRLHDSANQKSCFTCCIL 303 >SB_54236| Best HMM Match : bZIP_1 (HMM E-Value=1.1) Length = 1188 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 270 KIPENALECHEYIEDENVEFPT 335 ++ E+ LEC EYI ++N EF T Sbjct: 513 EMSESILECFEYIPEKNTEFMT 534 >SB_56940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1981 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +3 Query: 225 QRREILHSCCGCRKPKIPENALECHEYIEDENVEFPTCC 341 QRRE + G K E H+ D NV F CC Sbjct: 731 QRREGFKTAEGSEARKQDERRFRLHQSSSDSNVYFSQCC 769 >SB_7455| Best HMM Match : HC2 (HMM E-Value=8.7) Length = 153 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +2 Query: 440 TKRAKSCCCRNERHPADTGRWRAQGQASPGIFNSRGAADGSDISSRRFID 589 TKR N + AD G + + A G+FN++ AD +++R D Sbjct: 6 TKRGADKGLFNNKRVADKGLFNNKRVADKGLFNNKRVADKGLFNNKRVAD 55 >SB_15593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1593 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +1 Query: 214 RCEIRDGKYFIAAVDVENQKYRKTHWNATNTSK 312 +C I G+Y+I + Q++R WNA +T++ Sbjct: 497 QCNIIHGRYYIFHHKKDVQRHRYLVWNANDTTR 529 >SB_16907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 886 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = +3 Query: 399 QPGELF-PDKPWKGQQNEPNP 458 QP ELF P+ P K QQN+P P Sbjct: 121 QPVELFAPNSPPKPQQNQPKP 141 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,166,528 Number of Sequences: 59808 Number of extensions: 545019 Number of successful extensions: 1594 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1415 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1593 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -