BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0007 (618 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47515| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) 29 2.3 SB_17452| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) 29 2.3 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_54554| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) 28 7.0 SB_52808| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) 28 7.0 SB_41510| Best HMM Match : Minor_tail_Z (HMM E-Value=3.5) 28 7.0 SB_40055| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) 28 7.0 SB_36653| Best HMM Match : ACBP (HMM E-Value=3.6) 28 7.0 SB_25596| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_20592| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_14108| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) 28 7.0 SB_9519| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) 28 7.0 SB_5126| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_3604| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_2129| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_54746| Best HMM Match : RVT_1 (HMM E-Value=8.4e-11) 28 7.0 SB_36062| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) 28 7.0 SB_32612| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) 28 7.0 SB_5327| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) 28 7.0 SB_36229| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) 27 9.2 >SB_47515| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) Length = 189 Score = 29.5 bits (63), Expect = 2.3 Identities = 27/94 (28%), Positives = 40/94 (42%), Gaps = 2/94 (2%) Frame = +1 Query: 325 DSQPQEKVCSTTKDVFW-DR-SKIRLLLKLCLEDRFKNINKQKTLWHDIASHVGTTADEC 498 DS E ++ W DR + +L + L + K +T W A HV +D Sbjct: 15 DSSFMEDAILNILNIRWQDRITNTEVLERANLPSVITTMRKAQTRW---AGHVCRMSDSR 71 Query: 499 CKKSEI*GELILGS*KRIG*AKKSNGCL*LHVKE 600 K + GEL GS K G K+ C+ H+K+ Sbjct: 72 IPKQLLYGELSRGSRKVGGQRKRYKDCIKSHLKD 105 >SB_17452| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) Length = 189 Score = 29.5 bits (63), Expect = 2.3 Identities = 27/94 (28%), Positives = 40/94 (42%), Gaps = 2/94 (2%) Frame = +1 Query: 325 DSQPQEKVCSTTKDVFW-DR-SKIRLLLKLCLEDRFKNINKQKTLWHDIASHVGTTADEC 498 DS E ++ W DR + +L + L + K +T W A HV +D Sbjct: 15 DSSFMEDAILNILNIRWQDRITNTEVLERANLPSVITTMRKAQTRW---AGHVCRMSDSR 71 Query: 499 CKKSEI*GELILGS*KRIG*AKKSNGCL*LHVKE 600 K + GEL GS K G K+ C+ H+K+ Sbjct: 72 IPKQLLYGELSRGSRKVGGQRKRYKDCIKSHLKD 105 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 262 ETGENRQFIHINEPPIIVQEHDSQPQE 342 E GE Q HIN I+V E PQE Sbjct: 1139 EVGEELQIFHINPGSIVVTELPPSPQE 1165 >SB_54554| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) Length = 137 Score = 27.9 bits (59), Expect = 7.0 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +1 Query: 433 INKQKTLWHDIASHVGTTADECCKKSEI*GELILGS*KRIG*AKKSNGCL*LHVKE 600 + K +T W A HV +D K + GEL GS K G K+ C+ H+K+ Sbjct: 1 MRKAQTRW---AGHVCRMSDSRIPKQLLYGELSRGSRKVGGQRKRYKDCIKSHLKD 53 >SB_52808| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) Length = 166 Score = 27.9 bits (59), Expect = 7.0 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +1 Query: 433 INKQKTLWHDIASHVGTTADECCKKSEI*GELILGS*KRIG*AKKSNGCL*LHVKE 600 + K +T W A HV +D K + GEL GS K G K+ C+ H+K+ Sbjct: 30 MRKAQTRW---AGHVCRMSDSRIPKQLLYGELSRGSRKVGGQRKRYKDCIKSHLKD 82 >SB_41510| Best HMM Match : Minor_tail_Z (HMM E-Value=3.5) Length = 208 Score = 27.9 bits (59), Expect = 7.0 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +1 Query: 433 INKQKTLWHDIASHVGTTADECCKKSEI*GELILGS*KRIG*AKKSNGCL*LHVKE 600 + K +T W A HV +D K + GEL GS K G K+ C+ H+K+ Sbjct: 141 MRKAQTRW---AGHVCRMSDSRIPKQLLYGELSRGSRKVGGQRKRYKDCIKSHLKD 193 >SB_40055| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) Length = 303 Score = 27.9 bits (59), Expect = 7.0 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +1 Query: 433 INKQKTLWHDIASHVGTTADECCKKSEI*GELILGS*KRIG*AKKSNGCL*LHVKE 600 + K +T W A HV +D K + GEL GS K G K+ C+ H+K+ Sbjct: 167 MRKAQTRW---AGHVCRMSDSRIPKQLLYGELSRGSRKVGGQRKRYKDCIKSHLKD 219 >SB_36653| Best HMM Match : ACBP (HMM E-Value=3.6) Length = 206 Score = 27.9 bits (59), Expect = 7.0 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 424 FKNINKQKTLWHDIASHVGTTADECCKK 507 FK+ NK++ W +A G + DE +K Sbjct: 39 FKDKNKKENAWKQVAEQAGCSVDEAKRK 66 >SB_25596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 27.9 bits (59), Expect = 7.0 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 424 FKNINKQKTLWHDIASHVGTTADECCKK 507 FK+ NK++ W +A G + DE +K Sbjct: 39 FKDKNKKENAWKQVAEQAGCSVDEAKRK 66 >SB_20592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.9 bits (59), Expect = 7.0 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +1 Query: 433 INKQKTLWHDIASHVGTTADECCKKSEI*GELILGS*KRIG*AKKSNGCL*LHVKE 600 + K +T W A HV +D K + GEL GS K G K+ C+ H+K+ Sbjct: 1 MRKAQTRW---AGHVCRMSDSRIPKQLLYGELSRGSRKVGGQRKRYKDCIKSHLKD 53 >SB_14108| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) Length = 404 Score = 27.9 bits (59), Expect = 7.0 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +1 Query: 433 INKQKTLWHDIASHVGTTADECCKKSEI*GELILGS*KRIG*AKKSNGCL*LHVKE 600 + K +T W A HV +D K + GEL GS K G K+ C+ H+K+ Sbjct: 268 MRKAQTRW---AGHVCRMSDSRIPKQLLYGELSRGSRKVGGQRKRYKDCIKSHLKD 320 >SB_9519| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) Length = 299 Score = 27.9 bits (59), Expect = 7.0 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +1 Query: 433 INKQKTLWHDIASHVGTTADECCKKSEI*GELILGS*KRIG*AKKSNGCL*LHVKE 600 + K +T W A HV +D K + GEL GS K G K+ C+ H+K+ Sbjct: 163 MRKAQTRW---AGHVCRMSDSRIPKQLLYGELSRGSRKVGGQRKRYKDCIKSHLKD 215 >SB_5126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 27.9 bits (59), Expect = 7.0 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +1 Query: 433 INKQKTLWHDIASHVGTTADECCKKSEI*GELILGS*KRIG*AKKSNGCL*LHVKE 600 + K +T W A HV +D K + GEL GS K G K+ C+ H+K+ Sbjct: 222 MRKAQTRW---AGHVCRMSDSRIPKQLLYGELSRGSRKVGGQRKRYKDCIKSHLKD 274 >SB_3604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1319 Score = 27.9 bits (59), Expect = 7.0 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +1 Query: 433 INKQKTLWHDIASHVGTTADECCKKSEI*GELILGS*KRIG*AKKSNGCL*LHVKE 600 + K +T W A HV +D K + GEL GS K G K+ C+ H+K+ Sbjct: 1183 MRKAQTRW---AGHVCRMSDSRIPKQLLYGELSRGSRKVGGQRKRYKDCIKSHLKD 1235 >SB_2129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 27.9 bits (59), Expect = 7.0 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +1 Query: 433 INKQKTLWHDIASHVGTTADECCKKSEI*GELILGS*KRIG*AKKSNGCL*LHVKE 600 + K +T W A HV +D K + GEL GS K G K+ C+ H+K+ Sbjct: 30 MRKAQTRW---AGHVCRMSDSRIPKQLLYGELSRGSRKVGGQRKRYKDCIKSHLKD 82 >SB_54746| Best HMM Match : RVT_1 (HMM E-Value=8.4e-11) Length = 959 Score = 27.9 bits (59), Expect = 7.0 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +1 Query: 433 INKQKTLWHDIASHVGTTADECCKKSEI*GELILGS*KRIG*AKKSNGCL*LHVKE 600 + K +T W A HV +D K + GEL GS K G K+ C+ H+K+ Sbjct: 887 MRKAQTRW---AGHVCRMSDSRIPKQLLYGELSRGSRKVGGQRKRYKDCIKSHLKD 939 >SB_36062| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) Length = 166 Score = 27.9 bits (59), Expect = 7.0 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +1 Query: 433 INKQKTLWHDIASHVGTTADECCKKSEI*GELILGS*KRIG*AKKSNGCL*LHVKE 600 + K +T W A HV +D K + GEL GS K G K+ C+ H+K+ Sbjct: 30 MRKAQTRW---AGHVCRMSDSRIPKQLLYGELSRGSRKVGGQRKRYKDCIKSHLKD 82 >SB_32612| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) Length = 166 Score = 27.9 bits (59), Expect = 7.0 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +1 Query: 433 INKQKTLWHDIASHVGTTADECCKKSEI*GELILGS*KRIG*AKKSNGCL*LHVKE 600 + K +T W A HV +D K + GEL GS K G K+ C+ H+K+ Sbjct: 30 MRKAQTRW---AGHVCRMSDSRIPKQLLYGELSRGSRKVGGQRKRYKDCIKSHLKD 82 >SB_5327| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) Length = 328 Score = 27.9 bits (59), Expect = 7.0 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +1 Query: 433 INKQKTLWHDIASHVGTTADECCKKSEI*GELILGS*KRIG*AKKSNGCL*LHVKE 600 + K +T W A HV +D K + GEL GS K G K+ C+ H+K+ Sbjct: 192 MRKAQTRW---AGHVCRMSDSRIPKQLLYGELSRGSRKVGGQRKRYKDCIKSHLKD 244 >SB_36229| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) Length = 269 Score = 27.5 bits (58), Expect = 9.2 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +1 Query: 433 INKQKTLWHDIASHVGTTADECCKKSEI*GELILGS*KRIG*AKKSNGCL*LHVKE 600 + K +T W A HV +D K + GEL GS K G K+ C+ H+K+ Sbjct: 133 MRKVQTRW---AGHVCRMSDSRIPKQLLYGELSRGSRKVGGQRKRYKDCIKSHLKD 185 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,634,508 Number of Sequences: 59808 Number of extensions: 331078 Number of successful extensions: 801 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 738 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 801 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -