BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0006 (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC244.01c |sid4||SIN component scaffold protein Sid4 |Schizosa... 26 6.0 SPAC24H6.03 |cul3|pcu3|cullin 3|Schizosaccharomyces pombe|chr 1|... 25 7.9 SPBC1778.04 |spo6||Spo4-Spo6 kinase complex regulatory subunit S... 25 7.9 SPBP4H10.04 |ppb1||calcineurin catalytic subunit Ppb1|Schizosacc... 25 7.9 >SPBC244.01c |sid4||SIN component scaffold protein Sid4 |Schizosaccharomyces pombe|chr 2|||Manual Length = 660 Score = 25.8 bits (54), Expect = 6.0 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = +3 Query: 393 LLLRQDYAPTRLSTSSTSPI 452 L+ +QDY PT +ST+ ++P+ Sbjct: 356 LMNQQDYCPTTMSTTVSTPL 375 >SPAC24H6.03 |cul3|pcu3|cullin 3|Schizosaccharomyces pombe|chr 1|||Manual Length = 785 Score = 25.4 bits (53), Expect = 7.9 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = +2 Query: 266 DAANSIMGIVVENIEPHIHWKPQLIDGILKYGDRVHTMS 382 +AA+ + +V + + HI Q+I +LKY D+V++ S Sbjct: 116 EAAHRFLSSLVNSWKDHIV-SMQMISSVLKYLDKVYSKS 153 >SPBC1778.04 |spo6||Spo4-Spo6 kinase complex regulatory subunit Spo6|Schizosaccharomyces pombe|chr 2|||Manual Length = 474 Score = 25.4 bits (53), Expect = 7.9 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +1 Query: 586 KSYCVAVWKATDDKAICLWEPHAVGPNGKNVFLXGRR 696 K V W+ T D LW A+ G+ F GRR Sbjct: 265 KPIAVREWEKTLDSGEILWPSLAITAQGRCPFNTGRR 301 >SPBP4H10.04 |ppb1||calcineurin catalytic subunit Ppb1|Schizosaccharomyces pombe|chr 2|||Manual Length = 554 Score = 25.4 bits (53), Expect = 7.9 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 275 NSIMGIVVENIEPHIHWKPQLID 343 N++M I N PH +W P +D Sbjct: 355 NNVMNIRQFNCSPHPYWLPNFMD 377 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,456,067 Number of Sequences: 5004 Number of extensions: 43374 Number of successful extensions: 101 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 99 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 101 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -