BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0005 (698 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_07_0220 + 28482589-28483752 73 3e-13 01_06_0049 - 25953811-25954131,25954223-25954903 69 3e-12 03_02_0709 + 10583621-10583626,10583711-10584712,10585304-10585669 66 3e-11 08_01_0395 - 3502750-3503033,3504844-3505663 46 4e-05 08_02_1097 + 24284494-24284496,24284946-24285407,24285476-242864... 43 3e-04 07_01_0287 - 2094333-2094542,2094719-2095999 42 6e-04 06_03_0766 - 24425486-24426245,24430766-24430855,24430951-244310... 40 0.002 04_04_1500 + 34010819-34011016,34013267-34013308,34014195-340142... 40 0.002 02_01_0703 + 5251901-5251950,5252783-5253554 39 0.003 04_01_0021 + 311914-312399,314218-314310,314391-314672,314754-31... 34 0.094 01_01_0521 - 3826257-3826616,3826758-3826918,3826992-3827049,382... 34 0.094 07_03_0944 + 22787933-22789906 34 0.12 02_02_0568 + 11577804-11578676,11578956-11579042,11579043-11579141 34 0.12 09_03_0048 + 11880848-11880952,11881030-11881312,11882667-118827... 32 0.50 10_07_0063 - 12502305-12503361,12503567-12503668,12504251-125043... 31 0.67 02_04_0624 + 24538095-24538183,24538429-24538612,24538725-245388... 31 1.2 08_01_0824 - 8000829-8001272 30 1.5 06_03_1309 + 29223197-29223240,29223358-29223592,29223695-292237... 30 2.0 05_01_0212 + 1601861-1603600 30 2.0 11_01_0676 - 5511755-5511831,5512857-5513052,5513462-5513577,551... 29 3.5 07_03_1620 - 28180020-28180862 29 3.5 06_01_1176 + 10112257-10113126 29 3.5 03_06_0186 - 32197461-32197751,32204940-32205548,32205603-32207009 29 3.5 03_05_0918 - 28785233-28786613,28786894-28787140,28787773-28788238 29 3.5 01_01_1089 - 8560008-8560220,8560456-8560977,8561095-8561283,856... 29 3.5 12_02_1133 - 26368323-26369457,26369556-26369635,26370145-263702... 29 4.7 10_05_0067 + 8756044-8756075,8756180-8756357,8756800-8757471 29 4.7 09_03_0031 + 11735431-11735728,11736704-11737041,11737150-117372... 29 4.7 06_03_1121 + 27767707-27768065,27768612-27769034,27770013-277701... 29 4.7 01_06_1805 - 39999987-40000169,40000648-40000974,40001724-400020... 29 4.7 06_03_0512 + 21633594-21633890 28 6.2 04_04_0372 + 24781572-24781612,24781696-24782413 28 6.2 03_05_0865 - 28365430-28367640 28 6.2 01_04_0146 - 16711102-16711288,16712038-16712760,16712848-16712888 28 6.2 06_03_0867 + 25534760-25539620,25540662-25540857,25540957-255411... 28 8.2 05_06_0141 - 25964706-25965473 28 8.2 05_04_0306 + 20058640-20059159,20060406-20060819,20060921-200611... 28 8.2 05_03_0474 + 14481063-14481403,14481597-14481710,14483428-144836... 28 8.2 03_05_0618 + 26177743-26178420,26179477-26179617 28 8.2 01_05_0024 - 17262504-17263308,17264251-17264399,17264879-172649... 28 8.2 >05_07_0220 + 28482589-28483752 Length = 387 Score = 72.5 bits (170), Expect = 3e-13 Identities = 30/50 (60%), Positives = 36/50 (72%) Frame = +1 Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405 CQFAHGV ELR + RHP+YKT++CR + G CPYG RCHF H+ A R Sbjct: 333 CQFAHGVAELRPVIRHPRYKTQVCRMVLAGGVCPYGHRCHFRHSITPADR 382 Score = 42.3 bits (95), Expect = 4e-04 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +1 Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402 +KTELC + G CPYG +C F H E R Sbjct: 313 FKTELCNKWEETGACPYGDQCQFAHGVAELR 343 Score = 33.9 bits (74), Expect = 0.12 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +2 Query: 197 YKTELCRPFEEAGVCKYGD 253 +KTELC +EE G C YGD Sbjct: 313 FKTELCNKWEETGACPYGD 331 >01_06_0049 - 25953811-25954131,25954223-25954903 Length = 333 Score = 69.3 bits (162), Expect = 3e-12 Identities = 29/50 (58%), Positives = 34/50 (68%) Frame = +1 Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405 CQFAHGV ELR + RHP+YKT +CR + CPYG RCHF H+ A R Sbjct: 279 CQFAHGVTELRPVIRHPRYKTAVCRMVLAGDVCPYGHRCHFRHSLTPAER 328 Score = 41.9 bits (94), Expect = 5e-04 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +1 Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402 +KTELC + G CPYG +C F H E R Sbjct: 259 FKTELCNKWEETGDCPYGDQCQFAHGVTELR 289 Score = 32.7 bits (71), Expect = 0.29 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +2 Query: 197 YKTELCRPFEEAGVCKYGD 253 +KTELC +EE G C YGD Sbjct: 259 FKTELCNKWEETGDCPYGD 277 >03_02_0709 + 10583621-10583626,10583711-10584712,10585304-10585669 Length = 457 Score = 65.7 bits (153), Expect = 3e-11 Identities = 27/52 (51%), Positives = 35/52 (67%) Frame = +1 Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411 C+FAHG++ELR + RHP+YKT C+ F + CPYG RCHF H+ A E Sbjct: 402 CRFAHGLQELRPVIRHPRYKTLPCQMFAAASGCPYGHRCHFRHSPLRAAAAE 453 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = +1 Query: 313 KTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402 KTELC + G CPYG RC F H +E R Sbjct: 384 KTELCNKWER-GACPYGARCRFAHGLQELR 412 >08_01_0395 - 3502750-3503033,3504844-3505663 Length = 367 Score = 45.6 bits (103), Expect = 4e-05 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 292 LQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405 +Q+ +KT +C + G+CP+G +CHF H A E + Sbjct: 240 MQKPSNWKTRICNKWEMTGYCPFGSKCHFAHGAAELHK 277 Score = 36.7 bits (81), Expect = 0.018 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +1 Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405 +KT+LC F + G CPY C+F H EE R+ Sbjct: 88 FKTKLCCKFRA-GTCPYVTNCNFAHGMEELRK 118 Score = 34.7 bits (76), Expect = 0.071 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = +1 Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411 YK C+ F++ CPYG C F+H+ E+++ RE Sbjct: 170 YKGRHCKKFYTDEGCPYGDACTFLHD-EQSKARE 202 >08_02_1097 + 24284494-24284496,24284946-24285407,24285476-24286450, 24286566-24286655,24286760-24287021,24287447-24287472 Length = 605 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +1 Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHF 378 C++AH ELR + PKY+TE CR + + C YG +C + Sbjct: 540 CEYAHSQDELRVIDARPKYRTEPCRYWLAGKGCWYGDKCRY 580 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = +1 Query: 271 GVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402 G + + Q+ + KT +C + G C G C + H+ +E R Sbjct: 507 GAIQAKGKQKMREPKTVMCPDWCRTGHCSSGDGCEYAHSQDELR 550 >07_01_0287 - 2094333-2094542,2094719-2095999 Length = 496 Score = 41.5 bits (93), Expect = 6e-04 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +1 Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411 KYKT+LC+TF S G C + C F H E ++E Sbjct: 439 KYKTKLCKTFTSGGLCLFAANCRFAHGEVELGKKE 473 Score = 29.9 bits (64), Expect = 2.0 Identities = 22/54 (40%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = +1 Query: 229 SGGL*IWG*-CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHN 387 SGGL ++ C+FAHG EL K E C F S CP G C F H+ Sbjct: 450 SGGLCLFAANCRFAHGEVELG--------KKEPCWYFFSGQTCPRGDTCGFRHS 495 >06_03_0766 - 24425486-24426245,24430766-24430855,24430951-24431070, 24431568-24431746,24432046-24432231,24432454-24432547, 24432679-24432743,24433652-24433987 Length = 609 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +1 Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405 +KT+LC F+ G C +G RCHF H E R+ Sbjct: 574 FKTKLCENFNK-GSCTFGDRCHFAHGESELRK 604 Score = 33.1 bits (72), Expect = 0.22 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 313 KTELCRTFHSVGFCPYGPRCHFVHNAEE 396 KT +C +++ C +G +CHF H E Sbjct: 414 KTRMCNKYNTAEGCKWGSKCHFAHGERE 441 Score = 32.3 bits (70), Expect = 0.38 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 5/33 (15%) Frame = +1 Query: 304 PKYKTELCRTFH-----SVGFCPYGPRCHFVHN 387 PKYK R FH S CP+G CHF+HN Sbjct: 343 PKYKP---RVFHRTSDGSTSGCPFGSSCHFLHN 372 >04_04_1500 + 34010819-34011016,34013267-34013308,34014195-34014204, 34014526-34014586,34014621-34014678,34015266-34015412, 34015643-34016205,34018942-34019728 Length = 621 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = +1 Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405 YKT+LC F G C +G RCHF H E R+ Sbjct: 588 YKTKLCENFVK-GTCTFGDRCHFAHGENEQRK 618 Score = 33.1 bits (72), Expect = 0.22 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 313 KTELCRTFHSVGFCPYGPRCHFVHNAEE 396 KT +C +++ C +G +CHF H E Sbjct: 417 KTRMCTKYNTAEGCKFGDKCHFAHGERE 444 >02_01_0703 + 5251901-5251950,5252783-5253554 Length = 273 Score = 39.1 bits (87), Expect = 0.003 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +1 Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405 +KT+LC F + G C +G RCHF H E R+ Sbjct: 239 FKTKLCENF-TKGSCTFGDRCHFAHGENELRK 269 Score = 35.9 bits (79), Expect = 0.031 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 304 PKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396 P KT LC +++ C +G +CHF H E Sbjct: 71 PTVKTRLCNKYNTAEGCKWGDKCHFAHGERE 101 >04_01_0021 + 311914-312399,314218-314310,314391-314672,314754-314826, 315273-315405,315476-315629,315763-315843,316174-316296, 316629-316787,316862-316996,317159-317254,317416-317910, 318651-318722,319496-319537 Length = 807 Score = 34.3 bits (75), Expect = 0.094 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 5/42 (11%) Frame = +1 Query: 298 RHPKYKTELCRTFH-----SVGFCPYGPRCHFVHNAEEARRR 408 +HP +KT LC F S C +G C + H+ EE R R Sbjct: 48 QHPMWKTSLCSFFRRRAASSADGCSHGDSCRYAHSEEELRPR 89 >01_01_0521 - 3826257-3826616,3826758-3826918,3826992-3827049, 3827426-3827497,3827582-3827639,3828231-3828347, 3828630-3828782,3829182-3829346,3829814-3830132, 3830276-3830780 Length = 655 Score = 34.3 bits (75), Expect = 0.094 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +1 Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402 YKT +C TF + G C + C F H EE R Sbjct: 57 YKTRVCETFVTSGRCMFEDGCTFAHGDEELR 87 >07_03_0944 + 22787933-22789906 Length = 657 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = +1 Query: 247 WG*CQFAHGVRELRNL--QRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEA 399 W C F H R ++HP Y C F G CP G C F H E+ Sbjct: 253 WTECPFVHPGENARRRDPRKHP-YTAVPCPNFRRPGGCPSGDSCEFSHGVFES 304 Score = 29.1 bits (62), Expect = 3.5 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = +1 Query: 214 PTV*RSGGL*IWG*CQFAHGVRELRNLQRHP-KYKTELCRTFHSVGFCPYGPRCHFVHNA 390 P R GG C+F+HGV E HP +Y+T LC+ G C F H+ Sbjct: 281 PNFRRPGGCPSGDSCEFSHGVFE---SWLHPSQYRTRLCKE----GAACARRICFFAHDE 333 Query: 391 EEAR 402 +E R Sbjct: 334 DELR 337 >02_02_0568 + 11577804-11578676,11578956-11579042,11579043-11579141 Length = 352 Score = 33.9 bits (74), Expect = 0.12 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +1 Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHN 387 Y+ ++C+ + G+C YG C F+H+ Sbjct: 188 YQPDICKDYKETGYCGYGDSCKFMHD 213 Score = 31.1 bits (67), Expect = 0.88 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +2 Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286 Y+ ++C+ ++E G C YGD+ + +Y Sbjct: 188 YQPDICKDYKETGYCGYGDSCKFMHDRGDY 217 >09_03_0048 + 11880848-11880952,11881030-11881312,11882667-11882770, 11883998-11884416,11884698-11884998,11885136-11885232, 11885719-11885864,11885975-11886103 Length = 527 Score = 31.9 bits (69), Expect = 0.50 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +1 Query: 295 QRHPKYK-TELCRTFHSVGFCPYGPRCHFVHNAEEAR 402 QRH + LC F S G CP G +C++ H+ EEAR Sbjct: 227 QRHGEAGGNRLCFKFTSSGSCPRGSKCNYRHD-EEAR 262 Score = 28.7 bits (61), Expect = 4.7 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +1 Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396 Y +C F + G C GP C F H+ + Sbjct: 265 YNRNVCFDFLNKGKCEKGPECRFAHSLSD 293 >10_07_0063 - 12502305-12503361,12503567-12503668,12504251-12504378, 12504653-12504764,12504876-12504927,12505260-12505517, 12505943-12506079,12506296-12506606 Length = 718 Score = 31.5 bits (68), Expect = 0.67 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 286 RNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHN 387 +N QR +K C + G+CPYG C F+H+ Sbjct: 685 QNPQRFRPWKP--CFIYQQQGWCPYGENCKFMHD 716 >02_04_0624 + 24538095-24538183,24538429-24538612,24538725-24538886, 24538988-24539225,24539301-24539370,24539439-24539530, 24539799-24539836,24540018-24540039,24540462-24540618, 24540702-24540753,24542144-24542207,24542279-24542362, 24543418-24543543,24543622-24543818,24543903-24544091, 24544186-24544434,24544507-24544556,24544977-24545059, 24545164-24545449,24545751-24545794,24545878-24546626 Length = 1074 Score = 30.7 bits (66), Expect = 1.2 Identities = 24/109 (22%), Positives = 48/109 (44%), Gaps = 2/109 (1%) Frame = +3 Query: 174 LRHQPQVATRPSSADRLKKRGFVN-MGIMPICSRRPRTTQSSASS*IQDGAVSHFPFGWL 350 L + P+ A + R+K + M I P+ + R ++ + I+D F F W+ Sbjct: 176 LLNDPRGAALEAIVSRIKMLSRLGTMKIAPLANVRFIAVSATIPN-IEDIDYLRFGFAWI 234 Query: 351 LSLWTALPFRA*RRGSKTQRTI-VARRFIGIALIGRIYGVVYERRVAIA 494 + W A+P +R + R + + + G+ L+ ++ +R A A Sbjct: 235 SAEWLAVPSEGIKRFGEEMRPVKLTTKVFGMVLVSHHIANIWPKRYAPA 283 >08_01_0824 - 8000829-8001272 Length = 147 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = -3 Query: 594 DRGSSCGEKRKLWPVLVATSQVESEASMEMRRAW-RSRPVAHIRRHRSAR*ERC 436 +R S +R+LW A + E + + RR+W R R RR RS R RC Sbjct: 94 ERRHSWRRRRRLWRRGGARGRAEVVVAGKRRRSWRRRRSRTRQRRRRSRRRRRC 147 >06_03_1309 + 29223197-29223240,29223358-29223592,29223695-29223783, 29223870-29223968,29224065-29224158,29224297-29224514, 29224861-29224967,29225298-29225472,29225596-29225743, 29226548-29226596,29228016-29228162,29229990-29229996, 29230417-29230482,29230773-29231991,29232073-29233149, 29233226-29233355,29233519-29233617,29233817-29233878, 29234429-29234533 Length = 1389 Score = 29.9 bits (64), Expect = 2.0 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +1 Query: 313 KTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411 + E+CR F G C YG +C ++H + ++++ Sbjct: 4 RQEICRNFQR-GSCKYGAQCRYLHASPHQQQQQ 35 >05_01_0212 + 1601861-1603600 Length = 579 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/51 (31%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +1 Query: 247 WG*CQFAH-GVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396 W C F H G R R Y C F G C G C + H E Sbjct: 209 WTECPFVHPGENARRRDPRRYSYSCVPCPEFRKGGSCRKGDACEYAHGVFE 259 >11_01_0676 - 5511755-5511831,5512857-5513052,5513462-5513577, 5513752-5514597,5515515-5515766,5522344-5525206 Length = 1449 Score = 29.1 bits (62), Expect = 3.5 Identities = 19/54 (35%), Positives = 28/54 (51%) Frame = +3 Query: 456 IYGVVYERRVAIATLAAFPLTPHSPPAMSPPAQATAFAFRRTNSPDPEDDRLPV 617 I+ +VY R + AA P P PPA +PP ++ A R + +P +DR V Sbjct: 1035 IFELVYPIRAGLLEDAA-PRLPTPPPA-TPPQKSPVEALRSSAAPRRAEDRREV 1086 >07_03_1620 - 28180020-28180862 Length = 280 Score = 29.1 bits (62), Expect = 3.5 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = +1 Query: 256 CQFAHGVRELRNLQRHP-KYKTELCRTFHSVGF-CPYGPRCHFVHNAEEAR 402 C++AHGV E L HP +++T +C S G CP C F H+A E R Sbjct: 116 CRYAHGVFE---LWLHPSRFRTRMC----SAGTRCP-RRICFFAHSAAELR 158 >06_01_1176 + 10112257-10113126 Length = 289 Score = 29.1 bits (62), Expect = 3.5 Identities = 20/48 (41%), Positives = 22/48 (45%), Gaps = 6/48 (12%) Frame = +3 Query: 495 TLAAFPLTPHSPPAMSPPA------QATAFAFRRTNSPDPEDDRLPVF 620 TL+A P S A+SPP QATAFA P P LP F Sbjct: 140 TLSAAVSQPSSVDALSPPPAPMFADQATAFASLFAPPPPPPSQALPAF 187 >03_06_0186 - 32197461-32197751,32204940-32205548,32205603-32207009 Length = 768 Score = 29.1 bits (62), Expect = 3.5 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = +3 Query: 141 AVSNAPPVNRLLRHQPQVATRPSSADRLKKRGFVNMGIMPICSRRPRT 284 A+ +PP LL +P R ++DRL +G+ N G P+C R T Sbjct: 656 AIIASPPRLTLLCLRP--VNRVWTSDRLATKGWQNNGRCPLCRREDET 701 >03_05_0918 - 28785233-28786613,28786894-28787140,28787773-28788238 Length = 697 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +3 Query: 486 AIATLAAFPLTPHSPPAMSPPAQATAFAFRRTNSP 590 A+ LA++P P PP PPA+A A R P Sbjct: 6 ALERLASWPTPPPPPPPPPPPAKAAAAEAERPCPP 40 >01_01_1089 - 8560008-8560220,8560456-8560977,8561095-8561283, 8561377-8561642,8561967-8562111,8562411-8562530, 8562611-8562930,8564161-8564341,8564434-8564580, 8565186-8565497,8566303-8566450,8566592-8566765, 8567385-8567446,8567499-8567571,8567628-8567683, 8568370-8568645,8569541-8569588,8569870-8569991, 8570258-8570413,8571037-8571079,8572624-8572701, 8572972-8573070,8573168-8573209,8573302-8573304 Length = 1264 Score = 29.1 bits (62), Expect = 3.5 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +1 Query: 277 RELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402 REL + P + E+C F G C G CHF H++ R Sbjct: 970 RELVHGYVQPALENEMC-VFFLNGSCNRGDTCHFSHSSRAPR 1010 >12_02_1133 - 26368323-26369457,26369556-26369635,26370145-26370201, 26370508-26370601,26371006-26371092,26371179-26371268, 26371396-26371649 Length = 598 Score = 28.7 bits (61), Expect = 4.7 Identities = 20/60 (33%), Positives = 27/60 (45%) Frame = +2 Query: 482 GRDRHARRISIDASLSTCDVATSTGHSFRFSPHELPRSGRRPTARF*PTFHRLSAISFIA 661 G+ +H + + I L+ CD SF S HE+ G P R T HR AI +A Sbjct: 346 GKTKHFQTLIISEELTLCDCPGLVFPSFSSSRHEMVSCGVLPIDRM--TKHR-EAIQVVA 402 >10_05_0067 + 8756044-8756075,8756180-8756357,8756800-8757471 Length = 293 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +3 Query: 210 SADRLKKRGFVNMGIMPICSRRPRTTQSSA 299 + DRL+KRG+ N + P+C R TQ SA Sbjct: 250 TVDRLQKRGWQNQQLCPLC----RVTQESA 275 >09_03_0031 + 11735431-11735728,11736704-11737041,11737150-11737285, 11737477-11737613,11737701-11737824,11738859-11739364 Length = 512 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -2 Query: 631 KSRLKTGSRSSSGSGEFVRRKAKAVACAGG 542 +SR ++GSRS SGSG RR + + GG Sbjct: 30 RSRSRSGSRSGSGSGSSRRRLPRKGSGGGG 59 >06_03_1121 + 27767707-27768065,27768612-27769034,27770013-27770175, 27770271-27770381,27770895-27770963,27771117-27771203, 27771967-27772752 Length = 665 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/46 (30%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = +1 Query: 256 CQFAHGVRELRN---LQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384 C+F E R +H + C + +GFCP GP C + H Sbjct: 92 CRFFRDFGECREPDCAYKHSYDDVKECNMY-KMGFCPNGPNCRYKH 136 >01_06_1805 - 39999987-40000169,40000648-40000974,40001724-40002017, 40002112-40002231,40002714-40002776,40003150-40003310, 40003864-40004035 Length = 439 Score = 28.7 bits (61), Expect = 4.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 325 CRTFHSVGFCPYGPRCHFVHNAEEA 399 C+ + G C +GP C F H E+A Sbjct: 131 CQYYLKTGTCKFGPTCKFHHPREKA 155 Score = 27.9 bits (59), Expect = 8.2 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +1 Query: 319 ELCRTFHSVGFCPYGPRCHFVH 384 ELC+ + G C +G C F H Sbjct: 382 ELCKFYSRYGICKFGANCKFDH 403 >06_03_0512 + 21633594-21633890 Length = 98 Score = 28.3 bits (60), Expect = 6.2 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = -1 Query: 482 PSLIYDAIDPPDESDANEPPGDDGSLRLASSALCTKWQR 366 PS+ Y + PP DA EPP +R S A W+R Sbjct: 55 PSITYRMMPPP-LPDALEPPTTTTMMRRTSRATAMVWER 92 >04_04_0372 + 24781572-24781612,24781696-24782413 Length = 252 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 Query: 522 HSPPAMSPPAQATAFAFRRTNSPDPEDDRLPVF 620 +S P ++PP A A RT P E R PVF Sbjct: 133 NSNPLVAPPPAAEQRALMRTPGPGGESARRPVF 165 >03_05_0865 - 28365430-28367640 Length = 736 Score = 28.3 bits (60), Expect = 6.2 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = +3 Query: 438 IALIGRIYGVVYERRVAIATLAAFPLT--PHSPPAMSPPAQATAFAFRRTNSPDPEDDR 608 +AL R V +RR A+ L + P P PP +PP +++ R ++ D + DR Sbjct: 22 LALERRQAAVTDQRRSALDLLQSLPRPPPPPPPPLSNPPRDSSSSHHRDSSDRDRDRDR 80 >01_04_0146 - 16711102-16711288,16712038-16712760,16712848-16712888 Length = 316 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 Query: 522 HSPPAMSPPAQATAFAFRRTNSPDPEDDRLPVF 620 +S P ++PP A A RT P E R PVF Sbjct: 145 NSNPLVAPPPAAEQRALMRTPGPGGESARRPVF 177 >06_03_0867 + 25534760-25539620,25540662-25540857,25540957-25541104, 25541673-25541751,25542151-25542238,25542330-25542600, 25542676-25542718,25542801-25542904,25543374-25543790 Length = 2068 Score = 27.9 bits (59), Expect = 8.2 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 301 HPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRR 408 H K+ + +C F + G CP G RC H + + + Sbjct: 1932 HKKH-SYVCPVFEATGECPQGSRCKLHHPKSKVKSK 1966 >05_06_0141 - 25964706-25965473 Length = 255 Score = 27.9 bits (59), Expect = 8.2 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +1 Query: 247 WG*CQFAH-GVRELRNLQRHPKYKTELCRTFHSV--GFCPYGPRCHFVHNAEE 396 W C +AH G R R Y E C F CP G C F H E Sbjct: 77 WTACPYAHPGEAARRRDPRRVAYTGEPCPDFRRRPGAACPRGSTCPFAHGTFE 129 >05_04_0306 + 20058640-20059159,20060406-20060819,20060921-20061190, 20062179-20062849 Length = 624 Score = 27.9 bits (59), Expect = 8.2 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +3 Query: 453 RIYGVVYERRVAIATLAAFPLT-PHSPPAMSPPAQATAFAFRRT 581 R + + VA+A A+ P T P PP+ + P T RRT Sbjct: 100 RCHSMASHAHVALALSASRPATRPPQPPSFAAPPLPTPITMRRT 143 >05_03_0474 + 14481063-14481403,14481597-14481710,14483428-14483676, 14485844-14486225 Length = 361 Score = 27.9 bits (59), Expect = 8.2 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = +3 Query: 513 LTPHSPPAMSPPAQ-ATAFAFRRTNSPDP 596 L+ SPP SP + ATAFA R + PDP Sbjct: 15 LSSSSPPPPSPGRRTATAFAVRPRSLPDP 43 >03_05_0618 + 26177743-26178420,26179477-26179617 Length = 272 Score = 27.9 bits (59), Expect = 8.2 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = -2 Query: 658 DERDRREPMKSRLKTGSRSSSGSGEFVRRKAKAVACAGGD 539 DE E +S++ GS+ SSGS + +RK + A GD Sbjct: 232 DEAGADEEDESKVANGSKGSSGSAQPNKRKRDSEDDANGD 271 >01_05_0024 - 17262504-17263308,17264251-17264399,17264879-17264978, 17265829-17265953,17267565-17267743,17269648-17270698 Length = 802 Score = 27.9 bits (59), Expect = 8.2 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +3 Query: 474 ERRVAIATLAAFPLTPHSPPAMSPPAQATAFAFRRTNSPDP 596 ++RV + ++ + P+TP PP +P AT RT P P Sbjct: 189 QKRVMMGSVGSSPVTPPPPPRPNPSPPAT-----RTTPPPP 224 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,474,723 Number of Sequences: 37544 Number of extensions: 416723 Number of successful extensions: 2043 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 1828 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2038 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -