BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0005 (698 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protei... 33 0.011 DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protei... 33 0.011 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 27 0.75 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 27 0.75 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 26 1.3 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 26 1.3 AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transf... 24 4.0 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 23 9.2 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 9.2 >DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 32.7 bits (71), Expect = 0.011 Identities = 8/29 (27%), Positives = 18/29 (62%) Frame = +1 Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396 Y+ ++C+ + G+C +G C F+H+ + Sbjct: 176 YQPDICKDYKETGYCGFGDSCKFLHDRSD 204 Score = 30.7 bits (66), Expect = 0.046 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = +2 Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286 Y+ ++C+ ++E G C +GD+ L ++Y Sbjct: 176 YQPDICKDYKETGYCGFGDSCKFLHDRSDY 205 >DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 32.7 bits (71), Expect = 0.011 Identities = 8/29 (27%), Positives = 18/29 (62%) Frame = +1 Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396 Y+ ++C+ + G+C +G C F+H+ + Sbjct: 176 YQPDICKDYKETGYCGFGDSCKFLHDRSD 204 Score = 30.7 bits (66), Expect = 0.046 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = +2 Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286 Y+ ++C+ ++E G C +GD+ L ++Y Sbjct: 176 YQPDICKDYKETGYCGFGDSCKFLHDRSDY 205 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 26.6 bits (56), Expect = 0.75 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 154 HHQ*TGSSATSHKSLQDRALPTV*RSGGL 240 HH GS ATSH ++Q A PT+ G + Sbjct: 24 HH---GSIATSHSTIQHHAAPTIQHVGSV 49 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 26.6 bits (56), Expect = 0.75 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 154 HHQ*TGSSATSHKSLQDRALPTV*RSGGL 240 HH GS ATSH ++Q A PT+ G + Sbjct: 24 HH---GSIATSHSTIQHHAAPTIQHVGSV 49 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 169 GSSATSHKSLQDRALPTV*RSGGL 240 GS ATSH S+Q A P + G + Sbjct: 26 GSIATSHSSIQHHAAPAIHHVGSI 49 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 154 HHQ*TGSSATSHKSLQDRALPTV*RSGGL 240 HH GS ATSH S+Q A P + G + Sbjct: 24 HH---GSIATSHSSIQHHAAPAIHHVGSV 49 >AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transferase o1 protein. Length = 248 Score = 24.2 bits (50), Expect = 4.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 337 HSVGFCPYGPRCHFVHNAEE 396 +S+ FCPY R H + +A++ Sbjct: 25 YSMRFCPYAQRVHLMLDAKK 44 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 23.0 bits (47), Expect = 9.2 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +1 Query: 265 AHGVRELRNLQRHPKYKTELCRT 333 +HG R L + QR YK EL T Sbjct: 233 SHGDRLLEDRQRFDNYKRELKET 255 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.0 bits (47), Expect = 9.2 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 486 AIATLAAFPLTPHSPPAMSPP 548 AIA LA + PH+PP + P Sbjct: 1257 AIAGLAQGSMGPHTPPPPNTP 1277 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 698,222 Number of Sequences: 2352 Number of extensions: 14196 Number of successful extensions: 81 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 81 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -