BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0004 (598 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0021 + 11307795-11308093,11308454-11308556,11309623-113099... 31 0.92 09_06_0081 + 20745627-20748144,20748211-20748308 30 1.6 09_02_0082 - 4060018-4061604 29 2.1 09_02_0080 - 4020020-4020047,4020160-4022044,4022079-4022817 29 2.1 08_02_0386 - 16575636-16575698,16575799-16575858,16575947-165762... 29 3.7 02_01_0075 - 522554-522616,522742-522748,523033-523136,523237-52... 28 4.9 03_02_0458 + 8643804-8643904,8643994-8644091,8644206-8644504,864... 28 6.5 07_03_0446 - 18285132-18285221,18285437-18285499,18285805-182858... 27 8.6 03_02_0263 - 6948618-6948818,6948909-6948971,6949078-6949146,694... 27 8.6 02_05_0300 + 27681204-27681656,27681745-27681840,27681933-276820... 27 8.6 >08_02_0021 + 11307795-11308093,11308454-11308556,11309623-11309931, 11310190-11310618 Length = 379 Score = 30.7 bits (66), Expect = 0.92 Identities = 16/47 (34%), Positives = 21/47 (44%) Frame = +1 Query: 205 SEEDWHKTRNSF*SIGTRSPXRGELYNGYXGREHRTSHPLEXAADRR 345 S ++W R SF R RG ++ Y GR+ R P A RR Sbjct: 120 SMQEWSSERCSFVQEALRGSGRGHIWAFYRGRQRRLGPPPPLPARRR 166 >09_06_0081 + 20745627-20748144,20748211-20748308 Length = 871 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 386 PRASAPPGPTPQRDYRPVPRTP 451 PR APP PTP PVP P Sbjct: 344 PRTLAPPAPTPPAPATPVPMPP 365 >09_02_0082 - 4060018-4061604 Length = 528 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 377 MXLPRASAPPGPTPQRDYRPVPRTPIL 457 + +PRA APP P P P+P P L Sbjct: 249 LRVPRAPAPPVPAPLAPTPPIPTPPAL 275 >09_02_0080 - 4020020-4020047,4020160-4022044,4022079-4022817 Length = 883 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +2 Query: 383 LPRASAPPGPTPQRDYRPVPRTPIL 457 +PRA APP P P P+P P L Sbjct: 360 VPRAPAPPVPAPPAPTPPIPTPPAL 384 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 Query: 383 LPRASAPPGPTPQRDYRPVPRTPI 454 +P A APP PTP + VP P+ Sbjct: 530 MPPAPAPPIPTPSMPFPTVPAPPV 553 >08_02_0386 - 16575636-16575698,16575799-16575858,16575947-16576239, 16576361-16576517,16576601-16576948,16577047-16577177, 16577417-16577882,16578425-16579132 Length = 741 Score = 28.7 bits (61), Expect = 3.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 386 PRASAPPGPTPQRDYRPVPRTP 451 P APP P R RP PR P Sbjct: 39 PATEAPPAPKQHRGPRPAPRNP 60 >02_01_0075 - 522554-522616,522742-522748,523033-523136,523237-523368, 525209-525401,525978-526330,526693-526791,526864-526935, 527062-527213,527338-527386,527755-527885,528067-528307, 528392-528565,528656-528797,529236-529282,529370-529450, 530170-530271,530345-530440,531437-531444,531575-531616, 531830-531894,534761-534853,534888-534959,535303-535509, 536318-537226,537503-538158 Length = 1429 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 383 LPRASAPPGPTPQRDYRPVPR 445 LPR+ APP P+P R PR Sbjct: 25 LPRSRAPPSPSPSTSSRAKPR 45 >03_02_0458 + 8643804-8643904,8643994-8644091,8644206-8644504, 8645930-8646460 Length = 342 Score = 27.9 bits (59), Expect = 6.5 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 386 PRASAPPGPTPQRDYRPVP 442 P APP P PQ+ +PVP Sbjct: 12 PHPQAPPPPPPQQQQQPVP 30 >07_03_0446 - 18285132-18285221,18285437-18285499,18285805-18285867, 18286079-18286129,18286413-18286506,18286696-18286856, 18287089-18287145,18287380-18287493,18287934-18287999, 18288063-18288266,18289207-18289284,18289669-18289788, 18290425-18290491,18290635-18290735,18290820-18290936, 18292024-18292107,18292181-18292309,18292385-18292510, 18292622-18292696,18292814-18292947,18293032-18293137, 18293220-18293276,18294387-18294573,18295244-18295407, 18296129-18296353,18296538-18296744,18297043-18297375, 18297604-18297993 Length = 1220 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 Query: 383 LPRASAPPGPTPQRDYRPVPRTPI 454 LPR PP P P + P PR P+ Sbjct: 22 LPRKRPPPSPPPPQPPCPPPRRPL 45 >03_02_0263 - 6948618-6948818,6948909-6948971,6949078-6949146, 6949232-6949297,6949380-6949526,6949608-6949702, 6949845-6950016,6952187-6952318,6953581-6953674, 6954067-6954184,6955884-6957057 Length = 776 Score = 27.5 bits (58), Expect = 8.6 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +2 Query: 350 LKYGDRVXTMXLPRASAPPGPTPQRDYRPVPRTP 451 L GD + P S P P PQ +P+PR P Sbjct: 77 LASGDLLYFTLSPLPSPSPPPQPQPQAQPLPRNP 110 >02_05_0300 + 27681204-27681656,27681745-27681840,27681933-27682022, 27682126-27682227,27682310-27682456,27683608-27683748, 27683749-27683808,27685133-27685230,27685308-27685410, 27685954-27686037 Length = 457 Score = 27.5 bits (58), Expect = 8.6 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -2 Query: 450 GVRGTGR*SRWGVGPGGAE 394 G G G ++WG GPGGA+ Sbjct: 84 GAGGAGGPNKWGRGPGGAD 102 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,657,508 Number of Sequences: 37544 Number of extensions: 164016 Number of successful extensions: 723 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 639 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 719 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -