BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0004 (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_947| Best HMM Match : Phage_term_smal (HMM E-Value=2.8) 28 6.6 SB_51745| Best HMM Match : DPRP (HMM E-Value=0.33) 27 8.7 SB_35583| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_34676| Best HMM Match : Peptidase_A17 (HMM E-Value=2.4e-13) 27 8.7 SB_28941| Best HMM Match : PI3_PI4_kinase (HMM E-Value=2.8026e-45) 27 8.7 SB_51743| Best HMM Match : DPRP (HMM E-Value=0.4) 27 8.7 SB_48429| Best HMM Match : PI3_PI4_kinase (HMM E-Value=7.7e-09) 27 8.7 SB_40159| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_1692| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 >SB_947| Best HMM Match : Phage_term_smal (HMM E-Value=2.8) Length = 237 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 329 PQLIDGILKYGDRVXTMXLP 388 PQL+DG+L+ G R+ LP Sbjct: 124 PQLVDGVLRVGGRIDKADLP 143 >SB_51745| Best HMM Match : DPRP (HMM E-Value=0.33) Length = 352 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 329 PQLIDGILKYGDRVXTMXLPRASAPP 406 PQL+DG+L+ G R+ +P + P Sbjct: 220 PQLVDGVLRVGGRIDRADIPWETKHP 245 >SB_35583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 989 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 329 PQLIDGILKYGDRVXTMXLPRASAPP 406 PQL+DG+L+ G R+ +P + P Sbjct: 727 PQLVDGVLRVGGRIDRADIPWETKHP 752 >SB_34676| Best HMM Match : Peptidase_A17 (HMM E-Value=2.4e-13) Length = 1012 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 329 PQLIDGILKYGDRVXTMXLPRASAPP 406 PQL+DG+L+ G R+ +P + P Sbjct: 945 PQLVDGVLRVGGRIDRADIPWETKHP 970 >SB_28941| Best HMM Match : PI3_PI4_kinase (HMM E-Value=2.8026e-45) Length = 2022 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 295 GREHRTSHPLEXAADRRNPQVRRQGXHDXSAQS 393 G+ TSHPL + + Q++RQ HD +S Sbjct: 1863 GQVCNTSHPLHSLQAKFDEQIKRQADHDKVLRS 1895 >SB_51743| Best HMM Match : DPRP (HMM E-Value=0.4) Length = 281 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 329 PQLIDGILKYGDRVXTMXLPRASAPP 406 PQL+DG+L+ G R+ +P + P Sbjct: 233 PQLVDGVLRVGGRIDRADIPWETKHP 258 >SB_48429| Best HMM Match : PI3_PI4_kinase (HMM E-Value=7.7e-09) Length = 1423 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 295 GREHRTSHPLEXAADRRNPQVRRQGXHDXSAQS 393 G+ TSHPL + + Q++RQ HD +S Sbjct: 251 GQVCNTSHPLHSLQAKFDEQIKRQADHDKVLRS 283 >SB_40159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1497 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 329 PQLIDGILKYGDRVXTMXLPRASAPP 406 PQL+DG+L+ G R+ +P + P Sbjct: 1144 PQLVDGVLRVGGRIDRADIPWETKHP 1169 >SB_1692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 329 PQLIDGILKYGDRVXTMXLPRASAPP 406 PQL+DG+L+ G R+ +P + P Sbjct: 150 PQLVDGVLRVGGRIDRADIPWETKHP 175 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,155,684 Number of Sequences: 59808 Number of extensions: 174969 Number of successful extensions: 482 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 481 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -