BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0002 (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-b... 27 0.46 L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase pro... 24 4.3 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 24 4.3 AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase p... 24 4.3 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 23 5.7 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 23 5.7 AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. 23 5.7 >AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-binding protein OBPjj10 protein. Length = 207 Score = 27.1 bits (57), Expect = 0.46 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 425 LTEEFFGFTFIKFQPCFLD 369 L++EFFG + F CFLD Sbjct: 111 LSKEFFGLVMVCFVKCFLD 129 >L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 23.8 bits (49), Expect = 4.3 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 450 ISLDEFLIKIRPPMSESRRK 509 I LD+FL+ +RP + RR+ Sbjct: 526 IELDKFLVALRPGANRIRRR 545 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/37 (32%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = +1 Query: 355 NSFMASRKQGWNLIKVKPKNSSVNSTQTV--VAQSVL 459 ++ ++ G + ++KPK + VNS+ T VA+S+L Sbjct: 1682 HTVLSGPNDGSSQTEMKPKQNCVNSSNTYNHVAESIL 1718 >AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 23.8 bits (49), Expect = 4.3 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 450 ISLDEFLIKIRPPMSESRRK 509 I LD+FL+ +RP + RR+ Sbjct: 526 IELDKFLVALRPGANRIRRR 545 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.4 bits (48), Expect = 5.7 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 444 GSISLDEFLIKIRPPMSESRRKL*NK 521 G L FL RPP E+ RKL +K Sbjct: 350 GKDFLPRFLFMKRPPYIENHRKLLSK 375 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.4 bits (48), Expect = 5.7 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 444 GSISLDEFLIKIRPPMSESRRKL*NK 521 G L FL RPP E+ RKL +K Sbjct: 350 GKDFLPRFLFMKRPPYIENHRKLLSK 375 >AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. Length = 391 Score = 23.4 bits (48), Expect = 5.7 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +1 Query: 124 KVKAEMESSVAWHRPMSAGSVQEEELMQKSARAMTQATDPLEKLA 258 K+ A M + PM A + EE +++ +A +PL+K A Sbjct: 103 KIDAAMANFKTLFEPMKADLAKLEEEVKRQVLDAWKALEPLQKEA 147 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 561,509 Number of Sequences: 2352 Number of extensions: 10502 Number of successful extensions: 17 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -