Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= rbmte14m21
         (766 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026037-1|AAY87896.1|  431|Apis mellifera nicotinic acetylcholi...    25   1.0  
AY569719-1|AAS86672.1|  401|Apis mellifera feminizer protein.          22   7.2  
AY569718-1|AAS86671.1|  401|Apis mellifera feminizer protein.          22   7.2  
AY569715-1|AAS86668.1|  401|Apis mellifera feminizer protein.          22   7.2  
AY569714-1|AAS86667.1|  401|Apis mellifera feminizer protein.          22   7.2  
AY569713-1|AAS86666.1|  401|Apis mellifera feminizer protein.          22   7.2  
AY569711-1|AAS86664.1|  401|Apis mellifera feminizer protein.          22   7.2  
AY569702-1|AAS86655.1|  400|Apis mellifera feminizer protein.          22   7.2  
AY350616-1|AAQ57658.1|  401|Apis mellifera complementary sex det...    22   7.2  
AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine rece...    21   9.5  

>DQ026037-1|AAY87896.1|  431|Apis mellifera nicotinic acetylcholine
           receptor alpha9subunit protein.
          Length = 431

 Score = 24.6 bits (51), Expect = 1.0
 Identities = 12/41 (29%), Positives = 22/41 (53%)
 Frame = +1

Query: 370 NINISSCRAIKTSHFHIRIVLSVISFVIVRAIFIVIPHTLI 492
           N  +S  R  +++  H   ++  +SF IV   +I+I  TL+
Sbjct: 388 NSEVSKSRTKESAWRHFAAIIEWLSFFIVIFTYIIILITLV 428


>AY569719-1|AAS86672.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.8 bits (44), Expect = 7.2
 Identities = 6/12 (50%), Positives = 11/12 (91%)
 Frame = -2

Query: 162 SSTNHSHYPDRY 127
           ++TNHSH+ +R+
Sbjct: 4   NTTNHSHHDERF 15


>AY569718-1|AAS86671.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.8 bits (44), Expect = 7.2
 Identities = 6/12 (50%), Positives = 11/12 (91%)
 Frame = -2

Query: 162 SSTNHSHYPDRY 127
           ++TNHSH+ +R+
Sbjct: 4   NTTNHSHHDERF 15


>AY569715-1|AAS86668.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.8 bits (44), Expect = 7.2
 Identities = 6/12 (50%), Positives = 11/12 (91%)
 Frame = -2

Query: 162 SSTNHSHYPDRY 127
           ++TNHSH+ +R+
Sbjct: 4   NTTNHSHHDERF 15


>AY569714-1|AAS86667.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.8 bits (44), Expect = 7.2
 Identities = 6/12 (50%), Positives = 11/12 (91%)
 Frame = -2

Query: 162 SSTNHSHYPDRY 127
           ++TNHSH+ +R+
Sbjct: 4   NTTNHSHHDERF 15


>AY569713-1|AAS86666.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.8 bits (44), Expect = 7.2
 Identities = 6/12 (50%), Positives = 11/12 (91%)
 Frame = -2

Query: 162 SSTNHSHYPDRY 127
           ++TNHSH+ +R+
Sbjct: 4   NTTNHSHHDERF 15


>AY569711-1|AAS86664.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.8 bits (44), Expect = 7.2
 Identities = 6/12 (50%), Positives = 11/12 (91%)
 Frame = -2

Query: 162 SSTNHSHYPDRY 127
           ++TNHSH+ +R+
Sbjct: 4   NTTNHSHHDERF 15


>AY569702-1|AAS86655.1|  400|Apis mellifera feminizer protein.
          Length = 400

 Score = 21.8 bits (44), Expect = 7.2
 Identities = 6/12 (50%), Positives = 11/12 (91%)
 Frame = -2

Query: 162 SSTNHSHYPDRY 127
           ++TNHSH+ +R+
Sbjct: 4   NTTNHSHHDERF 15


>AY350616-1|AAQ57658.1|  401|Apis mellifera complementary sex
           determiner protein.
          Length = 401

 Score = 21.8 bits (44), Expect = 7.2
 Identities = 6/12 (50%), Positives = 11/12 (91%)
 Frame = -2

Query: 162 SSTNHSHYPDRY 127
           ++TNHSH+ +R+
Sbjct: 4   NTTNHSHHDERF 15


>AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine
           receptor protein.
          Length = 694

 Score = 21.4 bits (43), Expect = 9.5
 Identities = 15/45 (33%), Positives = 21/45 (46%)
 Frame = +2

Query: 533 SSSSGIVTNSSFAEPEGPASSGSTHFRFAGPLCEEEELFDAIDGL 667
           SSS    + SSF     P S GS ++     L   ++L D I+ L
Sbjct: 88  SSSPSPSSPSSFFSSVSPTSLGSENYTGISDLFVFDDLNDYINRL 132


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 187,136
Number of Sequences: 438
Number of extensions: 3555
Number of successful extensions: 13
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 23911269
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)