BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= rbmte11d21
(834 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 25 0.86
DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 22 6.1
>AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase
alpha 1 subunit protein.
Length = 699
Score = 25.0 bits (52), Expect = 0.86
Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
Frame = +2
Query: 692 VPKTLWNLFISITPPLSEQSSSILLGDAAF-TAFP 793
VP+ NL S+ PLS +++ + +G A+F AFP
Sbjct: 262 VPEIEDNLETSLFRPLSSEATDLRMGVASFCKAFP 296
>DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex
determiner protein.
Length = 174
Score = 22.2 bits (45), Expect = 6.1
Identities = 8/11 (72%), Positives = 9/11 (81%)
Frame = +1
Query: 466 GPSGVFPRIIP 498
GPS +FPR IP
Sbjct: 145 GPSTLFPRFIP 155
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 236,937
Number of Sequences: 438
Number of extensions: 5375
Number of successful extensions: 51
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 51
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 51
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 26702940
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -