SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= rbmte10o16
         (821 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cycl...    25   1.1  
DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholi...    22   7.9  
DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholi...    22   7.9  

>AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cyclase
           alpha 1 subunit protein.
          Length = 699

 Score = 24.6 bits (51), Expect = 1.1
 Identities = 17/61 (27%), Positives = 27/61 (44%), Gaps = 6/61 (9%)
 Frame = +2

Query: 377 DVTKVLSELTEFNHTCE*KS------FEQNVFKFIVLFCINLSDY*RETA*LSLCQSCG* 538
           +VT + S++  F   C   +        QN+++    FC  L  Y  ET   + C +CG 
Sbjct: 489 EVTMLFSDIVGFTEICSTATPMMVINMLQNLYEQFDSFCGQLDVYKVETIGDAYCVACGL 548

Query: 539 H 541
           H
Sbjct: 549 H 549


>DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 21.8 bits (44), Expect = 7.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +1

Query: 1   RRKTXFYVKNII 36
           RRKT FY  NII
Sbjct: 241 RRKTLFYTVNII 252


>DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 21.8 bits (44), Expect = 7.9
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +1

Query: 1   RRKTXFYVKNII 36
           RRKT FY  NII
Sbjct: 241 RRKTLFYTVNII 252


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 194,765
Number of Sequences: 438
Number of extensions: 3471
Number of successful extensions: 10
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 26217432
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -