BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= rbmte10m22
(811 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
02_05_1248 - 35237036-35237252,35237843-35239491 28 7.6
>02_05_1248 - 35237036-35237252,35237843-35239491
Length = 621
Score = 28.3 bits (60), Expect = 7.6
Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 2/57 (3%)
Frame = -3
Query: 524 KKISGEY*AVGSGLALPLALLKSMGDG--NHSPSGGPYVRQPTRAIKKIQLTQLDCL 360
+ ++ Y A+GS AL + K + D NH PS +++ R ++I++ L CL
Sbjct: 539 QSLANAYNAMGS-YALAMEFQKRVVDSWRNHGPSARDELKEAIRLYEQIKIKALSCL 594
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,847,109
Number of Sequences: 37544
Number of extensions: 336289
Number of successful extensions: 595
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 582
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 595
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2209429392
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -