SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= rbmte10m08
         (869 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY069838-1|AAL39983.1|  555|Drosophila melanogaster SD08447p pro...    27   1.6  
AE014298-1054|AAF46269.1|  555|Drosophila melanogaster CG12155-P...    27   1.6  
BT012302-1|AAS77427.1|  778|Drosophila melanogaster RE56731p pro...    25   3.3  
AF220425-1|AAK68930.1|  778|Drosophila melanogaster serrano prot...    25   3.3  
AE013599-2797|AAM68430.1|  778|Drosophila melanogaster CG12758-P...    25   3.3  
AE013599-2796|AAM68429.1|  778|Drosophila melanogaster CG12758-P...    25   3.3  
AE013599-2795|AAM68428.1|  778|Drosophila melanogaster CG12758-P...    25   3.3  
AE013599-2794|AAF57617.2|  778|Drosophila melanogaster CG12758-P...    25   3.3  
AE014297-2437|AAF55492.1| 1186|Drosophila melanogaster CG7847-PA...    24   7.0  
AE014297-2438|AAN13756.1|  906|Drosophila melanogaster CG7847-PB...    24   7.1  
AE014296-609|AAG22237.2| 1531|Drosophila melanogaster CG11505-PB...    26   8.8  
AE014296-610|AAF47745.1| 1521|Drosophila melanogaster CG11505-PA...    26   8.8  

>AY069838-1|AAL39983.1|  555|Drosophila melanogaster SD08447p
           protein.
          Length = 555

 Score = 27.5 bits (58), Expect(2) = 1.6
 Identities = 9/30 (30%), Positives = 17/30 (56%)
 Frame = -3

Query: 489 ILENNETHMLAIFVKGKTMLEIGNHYHHHH 400
           + +  ET +L  + +G +   +  H+HHHH
Sbjct: 190 VSDEAETFILTAYEEGVSDDTVSQHHHHHH 219



 Score = 22.6 bits (46), Expect(2) = 1.6
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = -3

Query: 420 NHYHHHHISE 391
           +H+HHHH S+
Sbjct: 234 HHHHHHHQSQ 243


>AE014298-1054|AAF46269.1|  555|Drosophila melanogaster CG12155-PA
           protein.
          Length = 555

 Score = 27.5 bits (58), Expect(2) = 1.6
 Identities = 9/30 (30%), Positives = 17/30 (56%)
 Frame = -3

Query: 489 ILENNETHMLAIFVKGKTMLEIGNHYHHHH 400
           + +  ET +L  + +G +   +  H+HHHH
Sbjct: 190 VSDEAETFILTAYEEGVSDDTVSQHHHHHH 219



 Score = 22.6 bits (46), Expect(2) = 1.6
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = -3

Query: 420 NHYHHHHISE 391
           +H+HHHH S+
Sbjct: 234 HHHHHHHQSQ 243


>BT012302-1|AAS77427.1|  778|Drosophila melanogaster RE56731p
           protein.
          Length = 778

 Score = 25.0 bits (52), Expect(2) = 3.3
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = -3

Query: 420 NHYHHHHISE 391
           NHYHH HI E
Sbjct: 456 NHYHHGHIQE 465



 Score = 23.8 bits (49), Expect(2) = 3.3
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -3

Query: 423 GNHYHHHH 400
           G+H+HHHH
Sbjct: 445 GSHHHHHH 452


>AF220425-1|AAK68930.1|  778|Drosophila melanogaster serrano protein
           protein.
          Length = 778

 Score = 25.0 bits (52), Expect(2) = 3.3
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = -3

Query: 420 NHYHHHHISE 391
           NHYHH HI E
Sbjct: 456 NHYHHGHIQE 465



 Score = 23.8 bits (49), Expect(2) = 3.3
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -3

Query: 423 GNHYHHHH 400
           G+H+HHHH
Sbjct: 445 GSHHHHHH 452


>AE013599-2797|AAM68430.1|  778|Drosophila melanogaster CG12758-PD,
           isoform D protein.
          Length = 778

 Score = 25.0 bits (52), Expect(2) = 3.3
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = -3

Query: 420 NHYHHHHISE 391
           NHYHH HI E
Sbjct: 456 NHYHHGHIQE 465



 Score = 23.8 bits (49), Expect(2) = 3.3
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -3

Query: 423 GNHYHHHH 400
           G+H+HHHH
Sbjct: 445 GSHHHHHH 452


>AE013599-2796|AAM68429.1|  778|Drosophila melanogaster CG12758-PC,
           isoform C protein.
          Length = 778

 Score = 25.0 bits (52), Expect(2) = 3.3
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = -3

Query: 420 NHYHHHHISE 391
           NHYHH HI E
Sbjct: 456 NHYHHGHIQE 465



 Score = 23.8 bits (49), Expect(2) = 3.3
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -3

Query: 423 GNHYHHHH 400
           G+H+HHHH
Sbjct: 445 GSHHHHHH 452


>AE013599-2795|AAM68428.1|  778|Drosophila melanogaster CG12758-PB,
           isoform B protein.
          Length = 778

 Score = 25.0 bits (52), Expect(2) = 3.3
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = -3

Query: 420 NHYHHHHISE 391
           NHYHH HI E
Sbjct: 456 NHYHHGHIQE 465



 Score = 23.8 bits (49), Expect(2) = 3.3
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -3

Query: 423 GNHYHHHH 400
           G+H+HHHH
Sbjct: 445 GSHHHHHH 452


>AE013599-2794|AAF57617.2|  778|Drosophila melanogaster CG12758-PA,
           isoform A protein.
          Length = 778

 Score = 25.0 bits (52), Expect(2) = 3.3
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = -3

Query: 420 NHYHHHHISE 391
           NHYHH HI E
Sbjct: 456 NHYHHGHIQE 465



 Score = 23.8 bits (49), Expect(2) = 3.3
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -3

Query: 423 GNHYHHHH 400
           G+H+HHHH
Sbjct: 445 GSHHHHHH 452


>AE014297-2437|AAF55492.1| 1186|Drosophila melanogaster CG7847-PA,
           isoform A protein.
          Length = 1186

 Score = 24.2 bits (50), Expect(2) = 7.0
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = -3

Query: 429 EIGNHYHHHH 400
           ++ NH+HHHH
Sbjct: 641 QLPNHHHHHH 650



 Score = 23.4 bits (48), Expect(2) = 7.0
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 420 NHYHHHHISEI 388
           +H+HHHH S++
Sbjct: 649 HHHHHHHHSQL 659


>AE014297-2438|AAN13756.1|  906|Drosophila melanogaster CG7847-PB,
           isoform B protein.
          Length = 906

 Score = 24.2 bits (50), Expect(2) = 7.1
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = -3

Query: 429 EIGNHYHHHH 400
           ++ NH+HHHH
Sbjct: 361 QLPNHHHHHH 370



 Score = 23.4 bits (48), Expect(2) = 7.1
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 420 NHYHHHHISEI 388
           +H+HHHH S++
Sbjct: 369 HHHHHHHHSQL 379


>AE014296-609|AAG22237.2| 1531|Drosophila melanogaster CG11505-PB,
           isoform B protein.
          Length = 1531

 Score = 25.8 bits (54), Expect(2) = 8.8
 Identities = 7/8 (87%), Positives = 8/8 (100%)
 Frame = -3

Query: 423 GNHYHHHH 400
           G+HYHHHH
Sbjct: 965 GHHYHHHH 972



 Score = 21.4 bits (43), Expect(2) = 8.8
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 417 HYHHHHIS 394
           H+HHHH S
Sbjct: 969 HHHHHHNS 976


>AE014296-610|AAF47745.1| 1521|Drosophila melanogaster CG11505-PA,
           isoform A protein.
          Length = 1521

 Score = 25.8 bits (54), Expect(2) = 8.8
 Identities = 7/8 (87%), Positives = 8/8 (100%)
 Frame = -3

Query: 423 GNHYHHHH 400
           G+HYHHHH
Sbjct: 955 GHHYHHHH 962



 Score = 21.4 bits (43), Expect(2) = 8.8
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 417 HYHHHHIS 394
           H+HHHH S
Sbjct: 959 HHHHHHNS 966


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 37,449,847
Number of Sequences: 53049
Number of extensions: 778357
Number of successful extensions: 3022
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 2170
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2777
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 4209111660
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -