Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= rbmnc19c21
         (141 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC16D10.05 |mok13||alpha-1,3-glucan synthase Mok13|Schizosacch...    23   5.5  
SPAC24H6.09 |gef1||RhoGEF Gef1|Schizosaccharomyces pombe|chr 1||...    23   5.5  

>SPBC16D10.05 |mok13||alpha-1,3-glucan synthase
            Mok13|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 2358

 Score = 23.0 bits (47), Expect = 5.5
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 3    WSEPRNIPSFY 35
            W  P NIP+FY
Sbjct: 2127 WESPGNIPAFY 2137


>SPAC24H6.09 |gef1||RhoGEF Gef1|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 753

 Score = 23.0 bits (47), Expect = 5.5
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = +2

Query: 2   VERAPKHPIVLQKSV*YTGPSMRELSDIKL 91
           ++R  K+P++LQK +  T  S  E  D+ L
Sbjct: 463 LQRLLKYPLLLQKIIDVTPESSSERPDLVL 492


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 553,542
Number of Sequences: 5004
Number of extensions: 7014
Number of successful extensions: 11
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 2,362,478
effective HSP length: 27
effective length of database: 2,227,370
effective search space used: 42320030
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)