Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= rbmnc18n02
         (320 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related pro...    21   2.8  
DQ325090-1|ABD14104.1|  178|Apis mellifera complementary sex det...    20   6.4  
DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex det...    20   6.4  
AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex det...    20   6.4  
AY569697-1|AAS86650.1|  413|Apis mellifera complementary sex det...    20   6.4  
AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.              20   8.4  

>DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related
           protein STG-1 protein.
          Length = 397

 Score = 21.4 bits (43), Expect = 2.8
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = +1

Query: 145 MCVGINHRLELLCSEGFEFDPN 210
           +CV I+ R+E  CS   ++ PN
Sbjct: 106 VCVAISSRMEYECSR-IDYFPN 126


>DQ325090-1|ABD14104.1|  178|Apis mellifera complementary sex
           determiner protein.
          Length = 178

 Score = 20.2 bits (40), Expect = 6.4
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -3

Query: 309 NNINNKIYLINFI 271
           NN N K+Y  N+I
Sbjct: 98  NNYNKKLYYKNYI 110


>DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 20.2 bits (40), Expect = 6.4
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -3

Query: 309 NNINNKIYLINFI 271
           NN N K+Y  N+I
Sbjct: 109 NNYNKKLYYKNYI 121


>AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex
           determiner protein.
          Length = 419

 Score = 20.2 bits (40), Expect = 6.4
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -3

Query: 309 NNINNKIYLINFI 271
           NN N K+Y  N+I
Sbjct: 339 NNYNKKLYYKNYI 351


>AY569697-1|AAS86650.1|  413|Apis mellifera complementary sex
           determiner protein.
          Length = 413

 Score = 20.2 bits (40), Expect = 6.4
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -3

Query: 309 NNINNKIYLINFI 271
           NN N K+Y  N+I
Sbjct: 334 NNYNKKLYYKNYI 346


>AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.
          Length = 898

 Score = 19.8 bits (39), Expect = 8.4
 Identities = 10/35 (28%), Positives = 19/35 (54%)
 Frame = +1

Query: 154 GINHRLELLCSEGFEFDPNVKDCVPISDYGCTANQ 258
           G+   ++ + S+G +F  +VK  + ISD     +Q
Sbjct: 764 GVTLVVQEISSDGLKFAFDVKTTLNISDIALYPSQ 798


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 54,166
Number of Sequences: 438
Number of extensions: 913
Number of successful extensions: 6
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 50
effective length of database: 124,443
effective search space used:  6968808
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)