Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= rbmnc18e06
         (765 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292337-1|CAL23149.2|  452|Tribolium castaneum gustatory recept...    25   0.66 
AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    23   3.5  
AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor ...    22   4.7  
EF592538-1|ABQ95984.1|  582|Tribolium castaneum beta-N-acetylglu...    21   8.2  

>AM292337-1|CAL23149.2|  452|Tribolium castaneum gustatory receptor
           candidate 16 protein.
          Length = 452

 Score = 25.0 bits (52), Expect = 0.66
 Identities = 13/57 (22%), Positives = 28/57 (49%), Gaps = 1/57 (1%)
 Frame = -2

Query: 404 IINVYNKTEMCIRATFDGRYVVTHDILMCFVNKS-YVKQLLRGVDTCITLQQLVKMY 237
           ++N  N T + +    +GR+ V +D +   +N S  V +    +  C  ++ LV ++
Sbjct: 181 VVNTINLTFLTLLMILEGRFRVINDGIQALINDSRKVTRFPTELTFCNKIKHLVNLH 237


>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 22.6 bits (46), Expect = 3.5
 Identities = 7/18 (38%), Positives = 10/18 (55%)
 Frame = +2

Query: 74  YY*YKVFLIVNTQFLYFC 127
           YY Y  F+I     L++C
Sbjct: 213 YYFYSAFIIFTIHLLFYC 230



 Score = 21.4 bits (43), Expect = 8.2
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +2

Query: 377 FQFYYKHLLF 406
           + FYY HLLF
Sbjct: 259 YYFYYMHLLF 268


>AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor
           protein protein.
          Length = 585

 Score = 22.2 bits (45), Expect = 4.7
 Identities = 6/13 (46%), Positives = 8/13 (61%)
 Frame = -1

Query: 750 TYLHCGHSCLCTD 712
           T +H GH C C +
Sbjct: 354 TTIHAGHKCTCPE 366


>EF592538-1|ABQ95984.1|  582|Tribolium castaneum
          beta-N-acetylglucosaminidase NAG3 protein.
          Length = 582

 Score = 21.4 bits (43), Expect = 8.2
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +1

Query: 61 VVCCLLLIQSF 93
          VVCCLLL+ S+
Sbjct: 6  VVCCLLLMFSY 16


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 171,588
Number of Sequences: 336
Number of extensions: 3884
Number of successful extensions: 8
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 20546262
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)