Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= rbmnc17i07
         (575 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_05_0654 + 26479416-26479605,26480058-26480246,26480674-264809...    28   6.1  

>03_05_0654 +
           26479416-26479605,26480058-26480246,26480674-26480989,
           26481286-26481844
          Length = 417

 Score = 27.9 bits (59), Expect = 6.1
 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 1/62 (1%)
 Frame = -3

Query: 423 ENRVKLFYYHQPTEVHRWIRFSPNSLRYHYMHNNILYPPTILINIS-IFRFRGR*IDLAP 247
           E R  L    +P    +W+     +L Y Y++     P ++LI+IS  FR     +   P
Sbjct: 72  EQRFLLSRTKRPFTPSQWMELEHQALIYKYLNAKAPIPSSLLISISKSFRSSANRMSWRP 131

Query: 246 IY 241
           +Y
Sbjct: 132 LY 133


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,962,194
Number of Sequences: 37544
Number of extensions: 254627
Number of successful extensions: 443
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 440
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 443
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1340735508
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)