Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= rbmnc16c18
         (788 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY578801-1|AAT07306.1|  506|Anopheles gambiae dSmad2 protein.          25   2.0  
AY578803-1|AAT07308.1|  474|Anopheles gambiae mothers against Dp...    24   4.7  
Y17704-1|CAA76824.2|  401|Anopheles gambiae hypothetical protein...    24   6.2  

>AY578801-1|AAT07306.1|  506|Anopheles gambiae dSmad2 protein.
          Length = 506

 Score = 25.4 bits (53), Expect = 2.0
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -2

Query: 343 CA*WRWPSINPH 308
           C  WRWP +N H
Sbjct: 89  CRLWRWPDLNSH 100


>AY578803-1|AAT07308.1|  474|Anopheles gambiae mothers against Dpp
           protein.
          Length = 474

 Score = 24.2 bits (50), Expect = 4.7
 Identities = 6/13 (46%), Positives = 8/13 (61%)
 Frame = -2

Query: 346 FCA*WRWPSINPH 308
           +C  WRWP +  H
Sbjct: 102 YCRVWRWPDLQSH 114


>Y17704-1|CAA76824.2|  401|Anopheles gambiae hypothetical protein
           protein.
          Length = 401

 Score = 23.8 bits (49), Expect = 6.2
 Identities = 11/32 (34%), Positives = 16/32 (50%)
 Frame = -1

Query: 698 KLASEYYRVRGPTGRYYRAALRYVGCADGGEA 603
           K  + YY+  GP  R ++  L YV     G+A
Sbjct: 188 KERAAYYKAIGPVIRNFKLTLTYVTLLFAGDA 219


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 791,936
Number of Sequences: 2352
Number of extensions: 15952
Number of successful extensions: 29
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 28
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 82744797
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)