Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= rbmnc15e23
         (517 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q5KFG6 Cluster: Ras GTPase activator, putative; n=2; Fi...    32   8.9  

>UniRef50_Q5KFG6 Cluster: Ras GTPase activator, putative; n=2;
            Filobasidiella neoformans|Rep: Ras GTPase activator,
            putative - Cryptococcus neoformans (Filobasidiella
            neoformans)
          Length = 2665

 Score = 31.9 bits (69), Expect = 8.9
 Identities = 23/65 (35%), Positives = 32/65 (49%)
 Frame = +3

Query: 54   SKDCTRLSVCGAVGTGELGNADRAAWLGLSAK*CSY*GYNTSPHGKINLGA*SSKFIDLE 233
            SK    + V GAV   +  NA RA W+GL A  C      T P   I LG  +S+ +D +
Sbjct: 2224 SKFLGEVLVAGAVSV-DCANAWRARWMGLVAATCFQHNPATQPQAFIVLGYLASEEVDDD 2282

Query: 234  MMQWI 248
            ++  I
Sbjct: 2283 LIYQI 2287


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 483,350,564
Number of Sequences: 1657284
Number of extensions: 8838528
Number of successful extensions: 23905
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 23144
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23901
length of database: 575,637,011
effective HSP length: 95
effective length of database: 418,195,031
effective search space used: 31782822356
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)