Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= rbmnc13j01
         (394 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY549314-1|AAS37680.1| 1187|Homo sapiens tyrosine kinase 2 protein.    28   9.5  

>AY549314-1|AAS37680.1| 1187|Homo sapiens tyrosine kinase 2 protein.
          Length = 1187

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 18/73 (24%), Positives = 36/73 (49%), Gaps = 6/73 (8%)
 Frame = -2

Query: 387  TIANIRIRRVFGTVDDKQRNIVIIAMKYIVT------IPRHSVCFSSLISFTQRPKKICQ 226
            T+ +  I +  G  +D+    + + M+Y+        +PRHS+  + L+ F Q   +IC+
Sbjct: 953  TLYHEHIIKYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQ---QICE 1009

Query: 225  CFVCIYIRRKIHR 187
                ++ +  IHR
Sbjct: 1010 GMAYLHAQHYIHR 1022


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 36,894,824
Number of Sequences: 237096
Number of extensions: 568173
Number of successful extensions: 1285
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1246
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1285
length of database: 76,859,062
effective HSP length: 82
effective length of database: 57,417,190
effective search space used: 2756025120
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)