BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= rbmnc13e24
(777 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF277379-1|AAF78764.1| 989|Homo sapiens vitamin D receptor-inte... 30 8.1
>AF277379-1|AAF78764.1| 989|Homo sapiens vitamin D
receptor-interacting protein complex component DRIP100
protein.
Length = 989
Score = 30.3 bits (65), Expect = 8.1
Identities = 15/47 (31%), Positives = 22/47 (46%)
Frame = +2
Query: 41 PGYSCLREDRADGYGGVCLLIRNSSTFSSFPLPSHSNCFSVIAAIVD 181
P + C R D G + L+ NSS + H C S+ AAI++
Sbjct: 542 PDHPCFRPDSTK-VGSLVALLNNSSEMKLVQMKWHEACLSISAAILE 587
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 103,530,727
Number of Sequences: 237096
Number of extensions: 2177305
Number of successful extensions: 3525
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3408
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3525
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9423020542
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -