BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= rbmnc13d03
(794 letters)
Database: spombe
5004 sequences; 2,362,478 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SPAC22H10.10 |alp21|sto1|tubulin specific chaperone cofactor E|S... 26 7.1
>SPAC22H10.10 |alp21|sto1|tubulin specific chaperone cofactor
E|Schizosaccharomyces pombe|chr 1|||Manual
Length = 511
Score = 25.8 bits (54), Expect = 7.1
Identities = 17/57 (29%), Positives = 30/57 (52%)
Frame = +1
Query: 343 KLPIGHANKM*IIYESSD*RNNIVNLEHSEVKQAARHARMFCSYIKFNK*QYFAKLI 513
+LP+ +K+ + S + +I +L+H + +H R+ SY FNK AKL+
Sbjct: 283 ELPVHTLHKLTFLDISENNIRDIRSLDHLRTLENLKHLRITLSY--FNKPTDIAKLL 337
Database: spombe
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 2,362,478
Number of sequences in database: 5004
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,078,627
Number of Sequences: 5004
Number of extensions: 62736
Number of successful extensions: 145
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 137
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 145
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 387388442
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -