SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= rbmnc12e04
         (864 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

09_02_0399 - 8569478-8569795,8570219-8570287,8570760-8570848,857...    28   8.4  

>09_02_0399 -
           8569478-8569795,8570219-8570287,8570760-8570848,
           8571446-8571542,8571920-8571991
          Length = 214

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 10/31 (32%), Positives = 20/31 (64%)
 Frame = -3

Query: 262 IRVY*SKFVPSNICVNRIKIMYVVSRRSKVN 170
           +++Y S+F+  N+ V   ++ Y+V RR  +N
Sbjct: 23  MKIYLSRFININMNVKNARMTYIVKRREYIN 53


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,745,626
Number of Sequences: 37544
Number of extensions: 308084
Number of successful extensions: 556
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 552
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 556
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2420970504
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -