BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= rbmnc12d24
(522 letters)
Database: tribolium
336 sequences; 122,585 total letters
Searching.......................................................done
Score E
Sequences producing significant alignments: (bits) Value
X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 23 1.6
AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 21 6.6
>X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein.
Length = 524
Score = 23.0 bits (47), Expect = 1.6
Identities = 13/35 (37%), Positives = 19/35 (54%)
Frame = -2
Query: 281 APPNEKPEIVKTHLRNMIIVPEMVGSIVGIYNGKT 177
A PN KP+ + HLR + EM G+++ KT
Sbjct: 134 ASPNRKPDDNQDHLRRL----EMSLEKSGLFSSKT 164
>AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase
subunit 1 protein.
Length = 682
Score = 21.0 bits (42), Expect = 6.6
Identities = 5/8 (62%), Positives = 7/8 (87%)
Frame = -3
Query: 334 LNVNQWHW 311
LN++ WHW
Sbjct: 203 LNLHHWHW 210
Database: tribolium
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 122,585
Number of sequences in database: 336
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 107,627
Number of Sequences: 336
Number of extensions: 2030
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 12573240
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -