SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= rbmnc12b19
         (767 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667184-1|ABG75736.1|  489|Apis mellifera GABA-gated ion channe...    21   9.5  
AF388659-3|AAK71993.1|  548|Apis mellifera 1D-myo-inositol-trisp...    21   9.5  
AF388659-2|AAK71994.1|  463|Apis mellifera 1D-myo-inositol-trisp...    21   9.5  
AF388659-1|AAK71995.1|  782|Apis mellifera 1D-myo-inositol-trisp...    21   9.5  
AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ...    21   9.5  

>DQ667184-1|ABG75736.1|  489|Apis mellifera GABA-gated ion channel
           protein.
          Length = 489

 Score = 21.4 bits (43), Expect = 9.5
 Identities = 14/37 (37%), Positives = 18/37 (48%)
 Frame = -3

Query: 354 VVTTFHRVGENEWLLPVTGIQEASRLSGHIKVPNGVR 244
           V  TF    +N +L  VT   +  RLSG   V  G+R
Sbjct: 118 VPDTFFANDKNSFLHDVTERNKLVRLSGDGSVTYGMR 154


>AF388659-3|AAK71993.1|  548|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform C protein.
          Length = 548

 Score = 21.4 bits (43), Expect = 9.5
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = -2

Query: 226 QHVCLRDCAIAVR 188
           +H C+ DC + VR
Sbjct: 340 EHPCVMDCKVGVR 352


>AF388659-2|AAK71994.1|  463|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform B protein.
          Length = 463

 Score = 21.4 bits (43), Expect = 9.5
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = -2

Query: 226 QHVCLRDCAIAVR 188
           +H C+ DC + VR
Sbjct: 255 EHPCVMDCKVGVR 267


>AF388659-1|AAK71995.1|  782|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform A protein.
          Length = 782

 Score = 21.4 bits (43), Expect = 9.5
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = -2

Query: 226 QHVCLRDCAIAVR 188
           +H C+ DC + VR
Sbjct: 574 EHPCVMDCKVGVR 586


>AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein
           protein.
          Length = 1124

 Score = 21.4 bits (43), Expect = 9.5
 Identities = 15/73 (20%), Positives = 30/73 (41%)
 Frame = +2

Query: 473 KLKQVFSSFNGSKLPSSLKTLIIVFNTSCVKIIELTTPGNWWYRLSVSSNTS*PGSRICT 652
           K ++V  +    + P+++ T +   +     +I+     N W  LSVS         +  
Sbjct: 716 KHEEVSRTSTAGQFPTNVATTVTSMSIDQSTVIQTGANVNLWQPLSVSIPPPPSAQNVPQ 775

Query: 653 NASTLSTCSITIL 691
           N ++ +   I IL
Sbjct: 776 NTNSQAIPRIPIL 788


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 223,384
Number of Sequences: 438
Number of extensions: 4615
Number of successful extensions: 7
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 24032646
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -