Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= rbmnc11n16
         (298 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.          22   1.8  
DQ667195-1|ABG75747.1|  469|Apis mellifera cys-loop ligand-gated...    22   1.8  
AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.      22   1.8  
AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine rece...    21   3.2  
DQ026039-1|AAY87898.1|  427|Apis mellifera nicotinic acetylcholi...    20   5.6  
DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase ...    20   5.6  
DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase ...    20   5.6  
AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.              19   9.8  

>EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.
          Length = 683

 Score = 21.8 bits (44), Expect = 1.8
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = +1

Query: 226 YNMIWHIDNP 255
           Y + WH+D P
Sbjct: 39  YELFWHVDQP 48


>DQ667195-1|ABG75747.1|  469|Apis mellifera cys-loop ligand-gated
           ion channel subunit protein.
          Length = 469

 Score = 21.8 bits (44), Expect = 1.8
 Identities = 13/45 (28%), Positives = 21/45 (46%)
 Frame = -1

Query: 190 IVMGLECLKTKLVDSSLMFNSFMCALYIMIATVWSLKNNLTSFYA 56
           IV+G   + T +  +S + NS     YI  + +W L   +  F A
Sbjct: 264 IVLGTNTILTFMTLASKVENSLPKVSYIKASEIWFLGCTIFLFAA 308


>AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.
          Length = 683

 Score = 21.8 bits (44), Expect = 1.8
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = +1

Query: 226 YNMIWHIDNP 255
           Y + WH+D P
Sbjct: 39  YELFWHVDQP 48


>AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine
           receptor protein.
          Length = 694

 Score = 21.0 bits (42), Expect = 3.2
 Identities = 7/20 (35%), Positives = 12/20 (60%)
 Frame = -1

Query: 118 ALYIMIATVWSLKNNLTSFY 59
           A+Y+++   WSL   +  FY
Sbjct: 243 AVYVLVNGSWSLPGFVCDFY 262


>DQ026039-1|AAY87898.1|  427|Apis mellifera nicotinic acetylcholine
           receptor beta2subunit protein.
          Length = 427

 Score = 20.2 bits (40), Expect = 5.6
 Identities = 5/13 (38%), Positives = 10/13 (76%)
 Frame = -3

Query: 245 ICQIMLYGYIVCF 207
           I  ++L+G ++CF
Sbjct: 14  IINVLLHGQVICF 26


>DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase
           isoform B protein.
          Length = 931

 Score = 20.2 bits (40), Expect = 5.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +1

Query: 16  CMKTEQLEYFV 48
           C KT+Q+ YF+
Sbjct: 276 CRKTDQILYFI 286


>DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase
           isoform A protein.
          Length = 969

 Score = 20.2 bits (40), Expect = 5.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +1

Query: 16  CMKTEQLEYFV 48
           C KT+Q+ YF+
Sbjct: 314 CRKTDQILYFI 324


>AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.
          Length = 898

 Score = 19.4 bits (38), Expect = 9.8
 Identities = 5/12 (41%), Positives = 10/12 (83%)
 Frame = +2

Query: 95  CCNHNVQSAHKR 130
           C +H++++AH R
Sbjct: 150 CLHHDIENAHIR 161


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 75,333
Number of Sequences: 438
Number of extensions: 1215
Number of successful extensions: 8
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 49
effective length of database: 124,881
effective search space used:  6119169
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.3 bits)