SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= rbmnc11h21
         (817 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.          22   7.8  
DQ667195-1|ABG75747.1|  469|Apis mellifera cys-loop ligand-gated...    22   7.8  
AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.      22   7.8  

>EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.
          Length = 683

 Score = 21.8 bits (44), Expect = 7.8
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = +1

Query: 226 YNMIWHIDNP 255
           Y + WH+D P
Sbjct: 39  YELFWHVDQP 48


>DQ667195-1|ABG75747.1|  469|Apis mellifera cys-loop ligand-gated
           ion channel subunit protein.
          Length = 469

 Score = 21.8 bits (44), Expect = 7.8
 Identities = 13/45 (28%), Positives = 21/45 (46%)
 Frame = -1

Query: 190 IVMGLECLKTKLVDSSLMFNSFMCALYIMIATVWSLKNNLTSFYA 56
           IV+G   + T +  +S + NS     YI  + +W L   +  F A
Sbjct: 264 IVLGTNTILTFMTLASKVENSLPKVSYIKASEIWFLGCTIFLFAA 308


>AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.
          Length = 683

 Score = 21.8 bits (44), Expect = 7.8
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = +1

Query: 226 YNMIWHIDNP 255
           Y + WH+D P
Sbjct: 39  YELFWHVDQP 48


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 223,514
Number of Sequences: 438
Number of extensions: 5012
Number of successful extensions: 12
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 25974678
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -