BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= rbmnc11g07
(820 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 7.8
DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 22 7.8
AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 7.8
>EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein.
Length = 683
Score = 21.8 bits (44), Expect = 7.8
Identities = 5/10 (50%), Positives = 7/10 (70%)
Frame = +1
Query: 226 YNMIWHIDNP 255
Y + WH+D P
Sbjct: 39 YELFWHVDQP 48
>DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated
ion channel subunit protein.
Length = 469
Score = 21.8 bits (44), Expect = 7.8
Identities = 13/45 (28%), Positives = 21/45 (46%)
Frame = -1
Query: 190 IVMGLECLKTKLVDSSLMFNSFMCALYIMIATVWSLKNNLTSFYA 56
IV+G + T + +S + NS YI + +W L + F A
Sbjct: 264 IVLGTNTILTFMTLASKVENSLPKVSYIKASEIWFLGCTIFLFAA 308
>AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein.
Length = 683
Score = 21.8 bits (44), Expect = 7.8
Identities = 5/10 (50%), Positives = 7/10 (70%)
Frame = +1
Query: 226 YNMIWHIDNP 255
Y + WH+D P
Sbjct: 39 YELFWHVDQP 48
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 225,373
Number of Sequences: 438
Number of extensions: 5066
Number of successful extensions: 12
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 26096055
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -