Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= rbmnc10p09
         (195 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AC024780-6|AAF60569.1|  259|Caenorhabditis elegans Ribosomal pro...    66   4e-12

>AC024780-6|AAF60569.1|  259|Caenorhabditis elegans Ribosomal
           protein, small subunitprotein 4 protein.
          Length = 259

 Score = 65.7 bits (153), Expect = 4e-12
 Identities = 30/64 (46%), Positives = 40/64 (62%)
 Frame = -2

Query: 194 LRNRXKYAXTGNEVXKIVKQXXIKVDGKVRTXLTYRXGXXDXVSIEKXNXXFXIIYDVKG 15
           LRNR KYA    E  KI+ Q  ++VDGKVRT   +  G  D V+IE+ N  F ++YD KG
Sbjct: 47  LRNRLKYALNYTEAKKILTQRVVRVDGKVRTCHKFPTGFMDVVAIERTNEYFRMLYDTKG 106

Query: 14  RFTI 3
           R+ +
Sbjct: 107 RYVV 110


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,167,319
Number of Sequences: 27780
Number of extensions: 16255
Number of successful extensions: 14
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 12,740,198
effective HSP length: 44
effective length of database: 11,517,878
effective search space used: 230357560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)