BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= rbmnc10c21
(413 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 25 1.1
AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 24 1.9
AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 24 1.9
>AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic
acetylcholine receptor subunitalpha 1 protein.
Length = 557
Score = 25.0 bits (52), Expect = 1.1
Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 3/48 (6%)
Frame = +2
Query: 269 EKHTLCRGIV---TIYFIAIITMFLCLSSTVPKTRRIRMLAMVVLTLT 403
EK +LC I+ T++F+ + + S TVP + + M+++TL+
Sbjct: 269 EKISLCISILLSLTVFFLLLAEIIPPTSLTVPLLGKYLLFTMMLVTLS 316
>AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr
phosphatase protein.
Length = 1977
Score = 24.2 bits (50), Expect = 1.9
Identities = 6/12 (50%), Positives = 9/12 (75%)
Frame = -2
Query: 334 KEHCNNCNEIYC 299
K HC +C +I+C
Sbjct: 1824 KHHCRSCGQIFC 1835
>AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr
phosphatase protein.
Length = 1978
Score = 24.2 bits (50), Expect = 1.9
Identities = 6/12 (50%), Positives = 9/12 (75%)
Frame = -2
Query: 334 KEHCNNCNEIYC 299
K HC +C +I+C
Sbjct: 1825 KHHCRSCGQIFC 1836
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 307,403
Number of Sequences: 2352
Number of extensions: 5960
Number of successful extensions: 11
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 563,979
effective HSP length: 58
effective length of database: 427,563
effective search space used: 33777477
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -