SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= rbmmt15m14
         (785 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY739658-1|AAU85297.1|  664|Apis mellifera hyperpolarization-act...    22   5.6  
AY280848-1|AAQ16312.1|  632|Apis mellifera hyperpolarization-act...    22   5.6  
EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.     22   7.4  

>AY739658-1|AAU85297.1|  664|Apis mellifera
           hyperpolarization-activated ion channelvariant L
           protein.
          Length = 664

 Score = 22.2 bits (45), Expect = 5.6
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 583 KIKILPCLLPTP 548
           +++ LPCLLP P
Sbjct: 622 ELRTLPCLLPRP 633


>AY280848-1|AAQ16312.1|  632|Apis mellifera
           hyperpolarization-activated ion channel protein.
          Length = 632

 Score = 22.2 bits (45), Expect = 5.6
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 583 KIKILPCLLPTP 548
           +++ LPCLLP P
Sbjct: 590 ELRTLPCLLPRP 601


>EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.
          Length = 570

 Score = 21.8 bits (44), Expect = 7.4
 Identities = 7/30 (23%), Positives = 13/30 (43%), Gaps = 3/30 (10%)
 Frame = +3

Query: 108 VPWPSD---RWRWVGGSTAIPWFRQLINTI 188
           +PW  +     +W  G T  PW   ++  +
Sbjct: 335 IPWDKNVEALAKWANGQTGFPWIDAIMTQL 364


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 206,751
Number of Sequences: 438
Number of extensions: 4854
Number of successful extensions: 5
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 24760908
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -