BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= rbmmt14f14
(754 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
06_01_1093 - 8970996-8971667,8971756-8971902,8971982-8972118,897... 28 6.9
>06_01_1093 -
8970996-8971667,8971756-8971902,8971982-8972118,
8972343-8972612,8972731-8972868,8974965-8975394
Length = 597
Score = 28.3 bits (60), Expect = 6.9
Identities = 17/62 (27%), Positives = 34/62 (54%)
Frame = +3
Query: 501 GFQNFILINCFILISILVTSRSHTRFTELAINCPIKIS*NSRSVLPSARNVYDIYTGKNR 680
GF+ F+L C++++S T +FT+ A++ I I+ + L +Y I+ G++
Sbjct: 208 GFRVFLLTFCYVMVSGYNTG----KFTDTAVSRFILIAIGAAVSLGINVGIYPIWAGQDL 263
Query: 681 YN 686
+N
Sbjct: 264 HN 265
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,239,109
Number of Sequences: 37544
Number of extensions: 282853
Number of successful extensions: 411
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 406
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 411
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 2004270760
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -