BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= rbmmt13m01
(254 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
L35848-1|AAA62319.1| 214|Homo sapiens IgE receptor beta subunit... 30 1.6
>L35848-1|AAA62319.1| 214|Homo sapiens IgE receptor beta subunit
protein.
Length = 214
Score = 29.9 bits (64), Expect = 1.6
Identities = 16/57 (28%), Positives = 29/57 (50%)
Frame = -3
Query: 252 PVSTRIQKNLNTKLIHNFNNLIQFKTSNLKMITDIQLAVFSNILGVSIFLLVILYHY 82
P S + LNT + H N ++ + L+++ IQ+ + IL + +FL + Y Y
Sbjct: 20 PGSETGPEELNTSVYHPINGSPDYQKAKLQVLGAIQILNAAMILALGVFLGSLQYPY 76
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 33,499,825
Number of Sequences: 237096
Number of extensions: 509056
Number of successful extensions: 4411
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 4411
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4411
length of database: 76,859,062
effective HSP length: 62
effective length of database: 62,159,110
effective search space used: 1367500420
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -