BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= rbmmt13f12
(661 letters)
Database: fruitfly
53,049 sequences; 24,988,368 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AE014135-39|AAF59363.2| 1459|Drosophila melanogaster CG31998-PA ... 28 9.8
>AE014135-39|AAF59363.2| 1459|Drosophila melanogaster CG31998-PA
protein.
Length = 1459
Score = 28.3 bits (60), Expect = 9.8
Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 2/62 (3%)
Frame = -1
Query: 277 NIQIYVCYLLHVIVNFYLFFSKFKYNK--YPMEEM*TVIRLLHCIYITFFRTFPFCFCIR 104
NI IY+ +L I++ Y + YNK + + V L I I R F CF
Sbjct: 615 NIHIYLSVVLFTILSVYSLYKLLTYNKLTHLFAQAYFVCINLILIMICILRIFFLCFDAY 674
Query: 103 NV 98
NV
Sbjct: 675 NV 676
Database: fruitfly
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 24,988,368
Number of sequences in database: 53,049
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,243,865
Number of Sequences: 53049
Number of extensions: 519459
Number of successful extensions: 916
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 899
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 916
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2827453950
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -