BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= rbmmt11l15
(706 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 4.9
AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 22 4.9
EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 6.5
>AY739658-1|AAU85297.1| 664|Apis mellifera
hyperpolarization-activated ion channelvariant L
protein.
Length = 664
Score = 22.2 bits (45), Expect = 4.9
Identities = 7/12 (58%), Positives = 10/12 (83%)
Frame = -1
Query: 610 KIKILPCLLPTP 575
+++ LPCLLP P
Sbjct: 622 ELRTLPCLLPRP 633
>AY280848-1|AAQ16312.1| 632|Apis mellifera
hyperpolarization-activated ion channel protein.
Length = 632
Score = 22.2 bits (45), Expect = 4.9
Identities = 7/12 (58%), Positives = 10/12 (83%)
Frame = -1
Query: 610 KIKILPCLLPTP 575
+++ LPCLLP P
Sbjct: 590 ELRTLPCLLPRP 601
>EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein.
Length = 570
Score = 21.8 bits (44), Expect = 6.5
Identities = 7/30 (23%), Positives = 13/30 (43%), Gaps = 3/30 (10%)
Frame = +3
Query: 135 VPWPSD---RWRWVGGSTAIPWFRQLINTI 215
+PW + +W G T PW ++ +
Sbjct: 335 IPWDKNVEALAKWANGQTGFPWIDAIMTQL 364
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 185,846
Number of Sequences: 438
Number of extensions: 4335
Number of successful extensions: 4
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21683070
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -