BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= rbmmt11f23
(747 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
BC064384-1|AAH64384.1| 769|Homo sapiens ABCB9 protein protein. 30 7.7
>BC064384-1|AAH64384.1| 769|Homo sapiens ABCB9 protein protein.
Length = 769
Score = 30.3 bits (65), Expect = 7.7
Identities = 13/41 (31%), Positives = 22/41 (53%)
Frame = +1
Query: 544 VARPPVIVLVEPVACDEWLGEYIKPQTQLAEHATVTRPAIV 666
V PPV++L E + + EY+ PQ Q A H + + ++
Sbjct: 658 VRNPPVLILDEATSALDAESEYLSPQIQQAIHGNLQKHTVL 698
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 99,937,891
Number of Sequences: 237096
Number of extensions: 2067293
Number of successful extensions: 2931
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2895
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2931
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8959138240
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -