Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= rbmmt10f19
         (243 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_04_0418 + 25077748-25078101,25079413-25079538,25080683-250815...    25   8.5  
02_05_0196 + 26638900-26639012,26639123-26639279                       25   8.5  

>04_04_0418 +
           25077748-25078101,25079413-25079538,25080683-25081593,
           25081970-25082453
          Length = 624

 Score = 25.0 bits (52), Expect = 8.5
 Identities = 11/34 (32%), Positives = 22/34 (64%)
 Frame = -3

Query: 103 CSFIVIIV*FLMYVV*LYSRKWIRSTEDTIGYGV 2
           C+ I++++ FL++   L+S  ++ +T   I YGV
Sbjct: 476 CTQIIMVITFLLFATGLHSLIYVSTTFLGICYGV 509


>02_05_0196 + 26638900-26639012,26639123-26639279
          Length = 89

 Score = 25.0 bits (52), Expect = 8.5
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = +2

Query: 5   AISDGILCRTYP 40
           A+S G LCRTYP
Sbjct: 76  ALSQGTLCRTYP 87


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 5,344,287
Number of Sequences: 37544
Number of extensions: 66179
Number of successful extensions: 123
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 123
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 123
length of database: 14,793,348
effective HSP length: 59
effective length of database: 12,578,252
effective search space used: 264143292
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)