Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= rbmmt10e09
         (714 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_01_1093 - 8970996-8971667,8971756-8971902,8971982-8972118,897...    28   6.4  

>06_01_1093 -
           8970996-8971667,8971756-8971902,8971982-8972118,
           8972343-8972612,8972731-8972868,8974965-8975394
          Length = 597

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 17/62 (27%), Positives = 34/62 (54%)
 Frame = +3

Query: 501 GFQNFILINCFILISILVTSRSHTRFTELAINCPIKIS*NSRSVLPSARNVYDIYTGKNR 680
           GF+ F+L  C++++S   T     +FT+ A++  I I+  +   L     +Y I+ G++ 
Sbjct: 208 GFRVFLLTFCYVMVSGYNTG----KFTDTAVSRFILIAIGAAVSLGINVGIYPIWAGQDL 263

Query: 681 YN 686
           +N
Sbjct: 264 HN 265


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,700,063
Number of Sequences: 37544
Number of extensions: 270613
Number of successful extensions: 384
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 378
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 384
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1851002996
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)