BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV31053.Seq (668 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 ... 156 2e-40 DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein ... 24 1.5 AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein ... 24 1.5 DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein ... 22 4.6 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 4.6 AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein ... 22 4.6 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 22 6.1 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 22 6.1 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 22 6.1 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 8.0 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 21 8.0 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 21 8.0 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 21 8.0 >AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 protein. Length = 208 Score = 156 bits (379), Expect = 2e-40 Identities = 68/75 (90%), Positives = 73/75 (97%) Frame = +1 Query: 31 MGISRDHWHKRRATGGKRAPIRKKRKYELGRPAANTRLGPQRIHSVRSRGGNTKYRALRL 210 MGISRDHWHKRRATGGKR PIRKKRK+ELGRPAANT+LGPQRIH+VR+RGGN KYRALRL Sbjct: 1 MGISRDHWHKRRATGGKRKPIRKKRKFELGRPAANTKLGPQRIHTVRTRGGNKKYRALRL 60 Query: 211 DTGNFSWGSECSTRK 255 DTGNFSWGSEC+TRK Sbjct: 61 DTGNFSWGSECTTRK 75 Score = 151 bits (365), Expect = 8e-39 Identities = 70/85 (82%), Positives = 76/85 (89%) Frame = +3 Query: 252 QTRIIDVVYNASNNELVRTKTLVKNAIVVVDATPFRQWYESHYTLPLGRKKGAKLTEAEE 431 +TRIIDVVYNASNNELVRTKTLVKNAIV +DATPFRQWYE HY LPLGRK+GAKLTEAEE Sbjct: 75 KTRIIDVVYNASNNELVRTKTLVKNAIVTIDATPFRQWYEGHYVLPLGRKRGAKLTEAEE 134 Query: 432 AIINKKRSQKTARKYLARQRLAKVE 506 ++NKKRS+K KY ARQR AKVE Sbjct: 135 EVLNKKRSKKAEAKYKARQRFAKVE 159 Score = 92.3 bits (219), Expect = 4e-21 Identities = 40/48 (83%), Positives = 46/48 (95%) Frame = +2 Query: 509 ALEEQFHTGRLLACVASRPGQCGRADGYILEGKELEFYLRKIKSKRAK 652 ALEEQF TGR+LAC++SRPGQCGR DGYILEGKELEFY+R+IKSK+AK Sbjct: 161 ALEEQFATGRVLACISSRPGQCGREDGYILEGKELEFYMRRIKSKKAK 208 >DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein 4 protein. Length = 128 Score = 23.8 bits (49), Expect = 1.5 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -1 Query: 338 YNNCILDKGLCT 303 Y NC+LD+G CT Sbjct: 46 YVNCLLDQGPCT 57 >AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein protein. Length = 128 Score = 23.8 bits (49), Expect = 1.5 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -1 Query: 338 YNNCILDKGLCT 303 Y NC+LD+G CT Sbjct: 46 YVNCLLDQGPCT 57 >DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein 6 protein. Length = 125 Score = 22.2 bits (45), Expect = 4.6 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 338 YNNCILDKGLCTHQ 297 Y C+LD+G CT++ Sbjct: 43 YIKCMLDEGPCTNE 56 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 4.6 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 545 PANALCGIALLEPLNLSK 492 P N+LC + L+ LNL++ Sbjct: 163 PVNSLCSLDNLQTLNLTE 180 >AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein protein. Length = 125 Score = 22.2 bits (45), Expect = 4.6 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 338 YNNCILDKGLCTHQ 297 Y C+LD+G CT++ Sbjct: 43 YIKCMLDEGPCTNE 56 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 21.8 bits (44), Expect = 6.1 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -1 Query: 371 LIPLPEWSCIYYNNC 327 L P P+WS Y++C Sbjct: 104 LQPYPDWSFAKYDDC 118 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.8 bits (44), Expect = 6.1 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -1 Query: 371 LIPLPEWSCIYYNNC 327 L P P+WS Y++C Sbjct: 104 LQPYPDWSFAKYDDC 118 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.8 bits (44), Expect = 6.1 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -1 Query: 371 LIPLPEWSCIYYNNC 327 L P P+WS Y++C Sbjct: 104 LQPYPDWSFAKYDDC 118 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.4 bits (43), Expect = 8.0 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -1 Query: 371 LIPLPEWSCIYYNNC 327 L P P+WS Y +C Sbjct: 109 LQPYPDWSFAKYEDC 123 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.4 bits (43), Expect = 8.0 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -1 Query: 371 LIPLPEWSCIYYNNC 327 L P P+WS Y +C Sbjct: 110 LRPYPDWSFAKYEDC 124 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.4 bits (43), Expect = 8.0 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -1 Query: 371 LIPLPEWSCIYYNNC 327 L P P+WS Y +C Sbjct: 108 LQPYPDWSWANYKDC 122 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.4 bits (43), Expect = 8.0 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -1 Query: 371 LIPLPEWSCIYYNNC 327 L P P+WS Y +C Sbjct: 108 LQPYPDWSWANYKDC 122 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,927 Number of Sequences: 438 Number of extensions: 3885 Number of successful extensions: 18 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20221290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -