BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV31049.Seq (698 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0437 - 19084990-19087695 28 8.2 04_01_0135 + 1516410-1516422,1516439-1516730,1516753-1516881,151... 28 8.2 >12_02_0437 - 19084990-19087695 Length = 901 Score = 27.9 bits (59), Expect = 8.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +1 Query: 67 LIVVCLEI*LICMQLNF*YTGEVLFSC*IEFP 162 LI +C L+C++LN Y GE L C FP Sbjct: 789 LISLCKMANLVCLELNCAYDGEALRFCAEWFP 820 >04_01_0135 + 1516410-1516422,1516439-1516730,1516753-1516881, 1516954-1516963 Length = 147 Score = 27.9 bits (59), Expect = 8.2 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +1 Query: 550 YIPYXSLECEIKAVGSGT--CSHHKSRPTKKXPYIR*QCYGPCGRK 681 Y PY S + A G G CSH +SR + Q Y C RK Sbjct: 98 YAPYRSEDLAPGAGGGGWIFCSHRQSRRAASDTVMVFQLYSCCSRK 143 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,667,950 Number of Sequences: 37544 Number of extensions: 377854 Number of successful extensions: 817 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 794 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 817 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -