BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV31043.Seq (558 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 25 1.7 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 23 5.1 AM690372-1|CAM84316.1| 353|Anopheles gambiae purine nucleoside ... 23 5.1 AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylch... 23 6.8 AY187043-1|AAO39757.1| 171|Anopheles gambiae putative antennal ... 23 6.8 AY146760-1|AAO12075.1| 313|Anopheles gambiae odorant-binding pr... 23 9.0 AF393487-1|AAL60412.1| 304|Anopheles gambiae odorant binding pr... 23 9.0 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 80 ETNVLKQEYTPDLHLTSPPTCLQWTTV 160 E + +YT D T+P CL+ TT+ Sbjct: 569 EFEFISPQYTVDKVATNPQNCLKQTTI 595 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 23.4 bits (48), Expect = 5.1 Identities = 13/58 (22%), Positives = 25/58 (43%) Frame = -1 Query: 306 PNIYYFRLTX*VY*QFTIVVPNTMHWDSFSFVLAFELLRFPFKFETD*LTVVHCRQVG 133 PN ++F + + +PN M +D+ +L ++ F T ++ C Q G Sbjct: 303 PNTFFFYMLPPIILDAGYFMPNRMFFDNIGTILLMAVIGTIFNIATIGGSLWACGQTG 360 >AM690372-1|CAM84316.1| 353|Anopheles gambiae purine nucleoside phosphorylase protein. Length = 353 Score = 23.4 bits (48), Expect = 5.1 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 153 VHCRQVGGDVK*RSGVYSCL 94 V RQ+G + + R GVY+CL Sbjct: 241 VIARQIGIENELREGVYTCL 260 >AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 5 protein. Length = 533 Score = 23.0 bits (47), Expect = 6.8 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +1 Query: 358 KYGLYSCTKDSRVYEWXI 411 +Y + C K R+Y+W I Sbjct: 4 RYHNFQCYKQLRIYKWII 21 >AY187043-1|AAO39757.1| 171|Anopheles gambiae putative antennal carrier protein AP-1 protein. Length = 171 Score = 23.0 bits (47), Expect = 6.8 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +2 Query: 35 YSTITKDGRLKIWDTETNVLKQEYTPDLH 121 Y+ I K+G + +D N T D+H Sbjct: 116 YAEIDKNGNIASFDNRGNTYNHSGTGDIH 144 >AY146760-1|AAO12075.1| 313|Anopheles gambiae odorant-binding protein AgamOBP31 protein. Length = 313 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 248 CLILCIGTHFRLYSH 204 CLI C+GT R +++ Sbjct: 67 CLIFCVGTDLRWWNN 81 >AF393487-1|AAL60412.1| 304|Anopheles gambiae odorant binding protein 1 protein. Length = 304 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 248 CLILCIGTHFRLYSH 204 CLI C+GT R +++ Sbjct: 67 CLIFCVGTDLRWWNN 81 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 560,696 Number of Sequences: 2352 Number of extensions: 10058 Number of successful extensions: 61 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52142868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -