BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV31039.Seq (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 24 3.2 AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding pr... 23 9.9 AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding pr... 23 9.9 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 24.2 bits (50), Expect = 3.2 Identities = 24/76 (31%), Positives = 38/76 (50%), Gaps = 2/76 (2%) Frame = +2 Query: 20 VVTQISATMSGGLDVLALNEEDVTKMLAATTHLGAENVNFQMETYVYKRRADGTH--VIN 193 +VT+++ + G+D+LA +EDV + L E T +++RR DGT + Sbjct: 202 IVTEMAEVLITGIDMLA-KKEDVERGL----QRALERTAVAATTSLWERR-DGTQRARVR 255 Query: 194 LRRTWEKLVLAARAVV 241 L R L+L R VV Sbjct: 256 LPRRDTDLLLDKRIVV 271 >AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding protein AgamOBP34 protein. Length = 311 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +3 Query: 249 RTR*CVRHLITALRSACCTEVCRAHRCY 332 RT C+ + CT+V +A +CY Sbjct: 119 RTEACLAENLYTCDDDLCTQVYKAFQCY 146 >AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding protein AgamOBP37 protein. Length = 311 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +3 Query: 249 RTR*CVRHLITALRSACCTEVCRAHRCY 332 RT C+ + CT+V +A +CY Sbjct: 119 RTEACLAENLYTCDDDLCTQVYKAFQCY 146 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 698,950 Number of Sequences: 2352 Number of extensions: 16653 Number of successful extensions: 19 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -