BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV31037.Seq (399 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 24 2.4 AF269155-1|AAF91400.1| 59|Anopheles gambiae transcription fact... 22 9.5 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 23.8 bits (49), Expect = 2.4 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = -2 Query: 116 ILCSXWVSAGSCPCYRQRCSYSRHFLLYF*HKIHF 12 ++C + CP R R +Y+R L + HF Sbjct: 125 VVCGDFAGPNGCPRRRGRQTYTRFQTLELEKEFHF 159 >AF269155-1|AAF91400.1| 59|Anopheles gambiae transcription factor Deformed protein. Length = 59 Score = 21.8 bits (44), Expect = 9.5 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 71 RQRCSYSRHFLLYF*HKIHF 12 RQR +Y+RH +L + H+ Sbjct: 3 RQRTAYTRHQILELEKEFHY 22 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 313,852 Number of Sequences: 2352 Number of extensions: 5122 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 31639662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -