BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV31031.Seq (499 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 24 1.0 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 22 4.1 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 22 4.1 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 22 4.1 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 22 4.1 AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc fi... 21 5.4 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 23.8 bits (49), Expect = 1.0 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +1 Query: 367 CKAR*TRYXCYTQLKVHFRSSRASK 441 CKA + C QLKVH R+ K Sbjct: 206 CKACGKGFTCSKQLKVHTRTHTGEK 230 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 21.8 bits (44), Expect = 4.1 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 13 RKSVFSGSSLTGELISISSLICPMSNSW 96 RKS S +SL LI ++ CP+ SW Sbjct: 226 RKSP-SLTSLNAYLIKNQTITCPIKVSW 252 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 21.8 bits (44), Expect = 4.1 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 13 RKSVFSGSSLTGELISISSLICPMSNSW 96 RKS S +SL LI ++ CP+ SW Sbjct: 226 RKSP-SLTSLNAYLIKNQTITCPIKVSW 252 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 21.8 bits (44), Expect = 4.1 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 13 RKSVFSGSSLTGELISISSLICPMSNSW 96 RKS S +SL LI ++ CP+ SW Sbjct: 277 RKSP-SLTSLNAYLIKNQTITCPIKVSW 303 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 21.8 bits (44), Expect = 4.1 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 13 RKSVFSGSSLTGELISISSLICPMSNSW 96 RKS S +SL LI ++ CP+ SW Sbjct: 226 RKSP-SLTSLNAYLIKNQTITCPIKVSW 252 >AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc finger domain-Z3 isoform protein. Length = 92 Score = 21.4 bits (43), Expect = 5.4 Identities = 9/33 (27%), Positives = 13/33 (39%) Frame = +1 Query: 349 LSHVQACKAR*TRYXCYTQLKVHFRSSRASKTT 447 ++ Q C + CY LK HF+ T Sbjct: 2 INEPQECPYCRRNFSCYYSLKRHFQDKHEQSDT 34 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,740 Number of Sequences: 438 Number of extensions: 2181 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -