BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV31030.Seq (609 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 33 0.001 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 33 0.001 AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory recept... 22 4.6 AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory recept... 22 4.6 AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory recept... 22 4.6 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 33.5 bits (73), Expect = 0.001 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +1 Query: 97 NFFRNKLKLMSFLRKRCNVNPARGPFHFRAP--SKILWKTVRGMI 225 N+ + ++ +SF K CN+ P+ F P K LWK ++G++ Sbjct: 5 NYSKKDIRSLSFFYKICNIFGIVPPYSFEKPDSQKSLWKKIQGVV 49 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 33.5 bits (73), Expect = 0.001 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +1 Query: 97 NFFRNKLKLMSFLRKRCNVNPARGPFHFRAP--SKILWKTVRGMI 225 N+ + ++ +SF K CN+ P+ F P K LWK ++G++ Sbjct: 5 NYSKKDIRSLSFFYKICNIFGIVPPYSFEKPDSQKSLWKKIQGVV 49 >AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory receptor candidate 47 protein. Length = 387 Score = 21.8 bits (44), Expect = 4.6 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = -2 Query: 485 LKFLFIGNSLNSLALPLVFKLTNNITVFPSNFMGQSAYMTVIT 357 L L I SL L L +VF LT + + +AY+ +IT Sbjct: 125 LSTLIIIISLGCLILAVVFLLTLSALLEGFTLYHTTAYLHIIT 167 >AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory receptor candidate 26 protein. Length = 387 Score = 21.8 bits (44), Expect = 4.6 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = -2 Query: 485 LKFLFIGNSLNSLALPLVFKLTNNITVFPSNFMGQSAYMTVIT 357 L L I SL L L +VF LT + + +AY+ +IT Sbjct: 125 LSTLIIIISLGCLILAVVFLLTLSALLEGFTLYHTTAYLHIIT 167 >AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory receptor candidate 6 protein. Length = 387 Score = 21.8 bits (44), Expect = 4.6 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = -2 Query: 485 LKFLFIGNSLNSLALPLVFKLTNNITVFPSNFMGQSAYMTVIT 357 L L I SL L L +VF LT + + +AY+ +IT Sbjct: 125 LSTLIIIISLGCLILAVVFLLTLSALLEGFTLYHTTAYLHIIT 167 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,399 Number of Sequences: 336 Number of extensions: 3278 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15457268 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -