BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV31027.Seq (548 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g39990.1 68415.m04914 eukaryotic translation initiation facto... 80 1e-15 At5g05780.1 68418.m00636 26S proteasome non-ATPase regulatory su... 73 2e-13 At3g11270.1 68416.m01370 26S proteasome non-ATPase regulatory su... 72 3e-13 At1g10840.1 68414.m01246 eukaryotic translation initiation facto... 48 4e-06 At5g01240.2 68418.m00032 amino acid permease, putative strong si... 30 0.89 At5g01240.1 68418.m00031 amino acid permease, putative strong si... 30 0.89 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 27 6.2 At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing ... 27 8.3 At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing ... 27 8.3 >At2g39990.1 68415.m04914 eukaryotic translation initiation factor 3 subunit 5 / eIF-3 epsilon / eIF3f (TIF3F1) identical to SP|O04202 Eukaryotic translation initiation factor 3 subunit 5 (eIF-3 epsilon) (eIF3 p32 subunit) (eIF3f) {Arabidopsis thaliana}; contains Pfam profile PF01398: Mov34/MPN/PAD-1 family Length = 293 Score = 79.8 bits (188), Expect = 1e-15 Identities = 34/84 (40%), Positives = 56/84 (66%), Gaps = 1/84 (1%) Frame = +1 Query: 1 ISVKVHPVVLFQIVDAYERRNADSHRVIGTLLGTS-DKGVVEVTNCFCVPHKEHADQVEA 177 ++ ++HP+V+F + D + RR + RVIGTLLG+ G V++ N + VPH E +DQV Sbjct: 26 LTARIHPLVIFNVCDCFVRRPDSAERVIGTLLGSILPDGTVDIRNSYAVPHNESSDQVAV 85 Query: 178 ELNYAMDVYELNRRVNSSESIVGW 249 +++Y ++ + +VNS E+IVGW Sbjct: 86 DIDYHHNMLASHLKVNSKETIVGW 109 Score = 53.6 bits (123), Expect = 8e-08 Identities = 27/81 (33%), Positives = 43/81 (53%) Frame = +3 Query: 255 TGNEVTNHSSVIHEYYSRECREPVHVTLDTSLAGGXMGLRAYVCVPLGVPNGKQGCMFTP 434 TG V SS+IH++Y+RE P+H+T+DT G ++A+V L + + + F Sbjct: 112 TGAGVNGGSSLIHDFYAREVPNPIHLTVDTGFTNGEGTIKAFVSSNLSLGDRQLVAHFQE 171 Query: 435 VDVTLTCYEPEIVGLQVCQKT 497 + V L + E VG V + T Sbjct: 172 IPVDLRMVDAERVGFDVLKAT 192 >At5g05780.1 68418.m00636 26S proteasome non-ATPase regulatory subunit 7, putative / 26S proteasome regulatory subunit S12, putative / MOV34 protein, putative contains similarity to 26s proteasome regulatory subunit s12 (proteasome subunit p40) (mov34 protein) SP:P26516 from [Mus musculus]; contains Pfam profile PF01398: Mov34/MPN/PAD-1 family Length = 308 Score = 72.5 bits (170), Expect = 2e-13 Identities = 38/91 (41%), Positives = 54/91 (59%), Gaps = 4/91 (4%) Frame = +1 Query: 7 VKVHPVVLFQIVDAYERRNADSH-RVIGTLLGTSDKGVVEVTNCFCVPHKEHADQVE--- 174 V VHP+VL IVD Y R DS RV+G LLG+S +GVV+VTN + VP +E Sbjct: 17 VVVHPLVLLSIVDHYNRVAKDSSKRVVGVLLGSSSRGVVDVTNSYAVPFEEDDKDPSIWF 76 Query: 175 AELNYAMDVYELNRRVNSSESIVGWXALAMK 267 + NY ++ + +R+N+ E +VGW + K Sbjct: 77 LDHNYHESMFHMFKRINAKEHVVGWYSTGPK 107 >At3g11270.1 68416.m01370 26S proteasome non-ATPase regulatory subunit 7, putative / 26S proteasome regulatory subunit S12, putative / MOV34 protein, putative contains similarity to 26S proteasome regulatory subunit S12 (MOV34) SP:P26516 from [Mus musculus] Length = 310 Score = 71.7 bits (168), Expect = 3e-13 Identities = 38/91 (41%), Positives = 53/91 (58%), Gaps = 4/91 (4%) Frame = +1 Query: 7 VKVHPVVLFQIVDAYERRNAD-SHRVIGTLLGTSDKGVVEVTNCFCVPHKEHADQVE--- 174 V VHP+VL IVD Y R D S RV+G LLG+S +G V+VTN + VP +E Sbjct: 17 VIVHPLVLLSIVDHYNRVAKDTSKRVVGVLLGSSSRGTVDVTNSYAVPFEEDDKDTSIWF 76 Query: 175 AELNYAMDVYELNRRVNSSESIVGWXALAMK 267 + NY ++ + +R+N+ E IVGW + K Sbjct: 77 LDHNYHESMFHMFKRINAKEHIVGWYSTGPK 107 >At1g10840.1 68414.m01246 eukaryotic translation initiation factor 3 subunit 3 / eIF-3 gamma / eIF3h (TIF3H1) identical to SP|Q9C5Z2 Eukaryotic translation initiation factor 3 subunit 3 (eIF-3 gamma) (eIF3 p38 subunit) (eIF3h) {Arabidopsis thaliana}; contains Pfam profile PF01398: Mov34/MPN/PAD-1 family Length = 337 Score = 48.0 bits (109), Expect = 4e-06 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 79 VIGTLLGTSDKGVVEVTNCFCVPHKEHADQVEAE-LNYAMDVYELNRRVNSSESIVGW 249 V G LLG V+EVTNCF P ++ +++EA+ NY +++ R VN + VGW Sbjct: 47 VTGQLLGLDVGSVLEVTNCFPFPVRDDDEEIEADGANYQLEMMRCLREVNVDNNTVGW 104 >At5g01240.2 68418.m00032 amino acid permease, putative strong similarity to AUX1 GI:1531758 from [Arabidopsis thaliana]; contains Pfam profile PF01490: Transmembrane amino acid transporter protein Length = 408 Score = 30.3 bits (65), Expect = 0.89 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -3 Query: 222 DSSVQLVNIHRVIKFRFDLIGMFFVWHAEAVGYFH 118 D++V L+ IH+ I F F ++FVW +A+G H Sbjct: 238 DTAVILMLIHQFITFGFACTPLYFVWE-KAIGMHH 271 >At5g01240.1 68418.m00031 amino acid permease, putative strong similarity to AUX1 GI:1531758 from [Arabidopsis thaliana]; contains Pfam profile PF01490: Transmembrane amino acid transporter protein Length = 488 Score = 30.3 bits (65), Expect = 0.89 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -3 Query: 222 DSSVQLVNIHRVIKFRFDLIGMFFVWHAEAVGYFH 118 D++V L+ IH+ I F F ++FVW +A+G H Sbjct: 318 DTAVILMLIHQFITFGFACTPLYFVWE-KAIGMHH 351 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 27.5 bits (58), Expect = 6.2 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -2 Query: 439 STGVNMQPCFPFGTPNGTQT--YARKPXXPPAXEVSRVTXTGSRHSR 305 +T + C P P T + + +P PP +S +T TG H R Sbjct: 71 TTNTGHRHCRPPSNPATTNSGHHQLRPPPPPPPPLSAITTTGHHHHR 117 >At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 27.1 bits (57), Expect = 8.3 Identities = 14/43 (32%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -2 Query: 463 GS*HVRVTSTGVNM-QPCFPFGTPNGTQTYARKPXXPPAXEVS 338 GS H V G+ M +P P+G G Y PPA ++ Sbjct: 260 GSGHGHVHGEGMGMVRPAGPYGAAGGISAYGGYSGGPPAHHMN 302 >At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 27.1 bits (57), Expect = 8.3 Identities = 14/43 (32%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -2 Query: 463 GS*HVRVTSTGVNM-QPCFPFGTPNGTQTYARKPXXPPAXEVS 338 GS H V G+ M +P P+G G Y PPA ++ Sbjct: 260 GSGHGHVHGEGMGMVRPAGPYGAAGGISAYGGYSGGPPAHHMN 302 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,385,086 Number of Sequences: 28952 Number of extensions: 259498 Number of successful extensions: 585 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 571 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 579 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -