BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV31023.Seq (598 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 2.0 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 23 2.6 DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 22 4.5 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 22 4.5 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 22 4.5 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.0 bits (47), Expect = 2.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -1 Query: 124 YCEISLFPFRDYFLLFSKFY*PSKVLFILLIIQNNVNKL 8 YC SL+P + F L P + + I +I N+ +L Sbjct: 313 YCAFSLYPLKSTFYLNVVRPFPERSMGITPMIWNSTRRL 351 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 22.6 bits (46), Expect = 2.6 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = -3 Query: 92 LFFIVFKILLTIKSTVHFINY 30 +F I F ++++ ST+HF+NY Sbjct: 199 IFGISFLLIISY-STLHFVNY 218 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 21.8 bits (44), Expect = 4.5 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -3 Query: 101 ISRLFFIVFKILLTIKSTVHFI 36 I ++ F+VF LLT S+V ++ Sbjct: 2 IFKIHFLVFGALLTYVSSVEYL 23 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 21.8 bits (44), Expect = 4.5 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 Query: 75 QNFINHQKYCSFY 37 +N+INHQ Y Y Sbjct: 369 ENYINHQNYVQGY 381 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 21.8 bits (44), Expect = 4.5 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 Query: 75 QNFINHQKYCSFY 37 +N+INHQ Y Y Sbjct: 317 ENYINHQNYVQGY 329 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,746 Number of Sequences: 336 Number of extensions: 2728 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -